SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L1I611 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L1I611
Domain Number 1 Region: 100-462
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.46e-76
Family Duffy binding domain 0.0000975
Further Details:      
 
Domain Number 2 Region: 1215-1582
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.1e-73
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 3 Region: 2043-2386,2417-2435
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.49e-64
Family Duffy binding domain 0.0000844
Further Details:      
 
Domain Number 4 Region: 890-1197
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.83e-56
Family Duffy binding domain 0.00038
Further Details:      
 
Domain Number 5 Region: 1652-1945,1981-2001
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.06e-56
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 6 Region: 2431-2746
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.06e-48
Family Duffy binding domain 0.0000523
Further Details:      
 
Domain Number 7 Region: 482-705
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-34
Family Duffy binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L1I611
Sequence length 3232
Comment (tr|A0A0L1I611|A0A0L1I611_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:KNG74645.1} KW=Complete proteome; Reference proteome OX=580059 OS=Plasmodium falciparum IGH-CR14. GN=PFMG_00867 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGSQESKPVDTSDVKNESHKSARNVFEYIAEIISNEVKKNAEKHDKSLQGDYKRAQFYQR
LLRAAEYVWTPPSNPCYFDFKFHTNAPNDRSKDRHPCYLRDINRFSNEGEAECNSSRITG
NKGGCGACAPYRRIQLCDYNLEHINDSNINSTDDLLGNLLVMAKSEGDSIVKSHENTGNG
IYKSGICTSLARSFADIGDIIRGKDLFLGHKEQKKKLQGNLQKIFNKFKTIYEDLKDVEI
DDIREYWWALNRNDVWEALTCSAPGDAKYVKYFPSNTTIVSFDQCGHNDMDVPTNLDYVP
QFLRWLNEWAEEFCRIKNIKIGNIKKSCTGESNNKHCSGEGYDCKRTDLKKNEIFMDLDC
PRCEEECTSYNEWLKKKEGEFNKQKKKYEMQLNGTESHVNIVNGSYYKAFYDELKNTNKH
DNFFKLLNKGQICQNIIEDIKISYDEPEKTFSRSEYCKSCPIFDLKCENGRCKSLDDISC
PNIPTMSNISTYKIENPIDINMLMNNNKTKELSPDLKIDFNDCDIFKRLRRQEWNCKYKC
NINVCELKNFEYGIDDEKHMLIEVLIKRWLKYFLKDYSQIKEKLNHCINKEKKELQCIKA
CKKNCECVEKWISKKEKEWTDIKARYIKQYESKDEDVSSKLKTFLQQGLFPEYIKNALDQ
DEKLDKMKESTECIEPNKPKGKSCKNNDVITILLNRLNDKIETCKKEHEGREGKECCDKL
PKSADGEDEDDEEQEDEPPAPTTPSTPNPCVNGGEDAGVGKITSVTDVAERMHMGAQKQM
LKRSGKGGGESKVAGKDSEKVSLLKGDIKKAKFKNGASPSSLEDVCGITDQHTKDSRRHH
RRRRLRLPPHRRLRLPPRRRRFLLPPLLLRLRFRGVYNGPCTGKDNKKIRFNIGENWKTG
DKVSTQDHVFLPPRREHFCTSNLEYLINGKYQKILNVENGKINHSFLGDVLLAAKYQAQH
TMNDYQIPNDQEGKCRAVRYSFADIGDIIRGRDLYLGYDDKEKEQRKKLEENLKTIFGNI
YEELTTTSGRTNGKTLQALYNDDTDKNYFKLREDWWEANRQEIWKAMTCDLKSGSFPCSD
KTTPHEDYIPQRLRWMTEWAEWYCKVQKEEYDKLKVCEKCMDNGKCTQGYVHQEATMNCE
KQTQFCKNKNGVKEANDAEDVNYTFKDTPNGYDVVCTCHNRKNPEALPKKKEEDACKIAQ
DIFKGKDENSTVGQCKKKDFGGKSYPDWKCEKNSKLVTGNGECMPPRRQKLCLYFLAHKI
ETPNLNTQEDLRKAFIKCAAAETFFSWYYFKKINDKLNKLDEKLKEGEIPPQFLRSMFYT
FGDYKDICLDTDISLKTVNGDITKAKSNIDRIIPKKSAKNPDEERKIWWDGIKEDVWKGM
LCGLSHAVSNNDKATVQKTLTTKTSIYDYDTVTFDGTTKLDDFSKRPQFLRWMTEWGEEF
CKKRKERVDKLVEDCKECNITNNASGGVTKTCERNSTGCKECTKACGDYKTWLETWKGHY
EKQKKKYKDDKKSYENDLDANNSDHAYEYLKKQLANIPCTNGTINGKCVYKCMDDKSISS
TDDMPASLDNEPQEVQGKCNCKSAPPEEVPKADEKQVEPKKDDICGEDGKTVDCGKVSKN
GEIKVPIDPKKNGDTHRNNDGERTNCAGIRTNKSEIKWKNNEDREYSHVKDMHKGVYIPP
RRQKLCVRGLKDAKDEIQLKTKLLSAAANDAYNLAVKYDDYKDNYTVPPCHALKYSFYDY
KYMILGEDPLEPDKDGTGKALKDLFNRKNSKGGGERSSKERQQFWDKYKSCVWEAMKCGY
KQGKTIGEQKAQGKGTKNDVNNIPDINGCTNNTPTEFDNVPQFLMWFTEWSEDFCRTRGV
KIKELEKGCKDYECNEENMDQQKKKCEEACQKYQTWLKDWKTQYEKQSQKFTKDKEKPEY
NGDPDVTSSENVYKYLSKKLKSICQNGSTTEKCDYKCMENASKQPQTSASSDQQDKSPEQ
KDLPEAFDYPPKEIGDRCTCPKLPEPKYCVDKTAYDIRKESGKKSDNSLKGNVNTYNDNC
KNAKREDYANQNGETCKIKETFWSTNNTSIKECDGNTKERFQIQKYWDCNGKTPDGKNTF
CIPPRRKDMCLKKLEDINVNDINDSSLLLKRIQEVAKKEGDDIIKKLLPKYPCNEDVICK
YMKYSFADLGDIIRGRDIYKNDNIKIEDNLKRAFNNVYNKNKQKRSKYNDNGDNNYTKLR
EAWWDTNRKAIWNAMTCSAPEDAKIYITKEGGYISPLTFTKNKCGHNDDPPDYDYIPQPF
RWLSEWSETYCLAQKDLLETMKNCENCMKKNKNADCEQTQYGACRDCKRKCEEYKKFIEI
WKKQFETQNKAYQEIYRNATSNGGKGEEIDENTKNFVKELEKNCKTDQKTSVDSADKYLE
NGGVCRRFKFVKTNTHIKNYAFHHTPPSYEEHCQCAKNFDPLDECPVDNNECKKYIKYVC
PKKKFNNELEAWTHRVIRRNPKNYEDVIVPARTRQLCLQNVTRNLIRIKNEKEFKEQLLI
SAASEAKLLSEQYHTERDKAFQAIKYSFADIGNIIKGDDIIGNVISVQLHKLINGNKKIN
TSTLWWEANKEKIWNVMMCHYKRDEKTTDMCPSHDNIDKEDQFLRWFREWSEHFCARRQK
LYEEVKNKCISFKCDTINGIIDPADCDEACTEYKNYITKKRQEYRIIMNQYNTNYKKKKE
QSKNASEYFQEKCNSKCQCLFEYIDKGKQWEEVYGSFDDNDLKNKCVCKKIKRIINPNKK
KNEDESASAQPKQEEDHIQPPPLTPKPDELPPPTPSTDNTSDILSSTIPFGIALALGSIA
FLFMKKKPKSTVDLIRVLDIHKGDYDIPTLKSKNRYIPYRSGSYKGKTYIYMEGDSSGDE
KYAFMSDTTDVTSSESEYEEMDINDIYVPDSPKYKTLIEVVLEPSKSNGNTPSKGDGNTL
GDDMVPTTNTFTDEEWNELKHDFISQYIQSRLPMDVPQYDVSKELPMNIVGNVLDDGINE
KPFITSIHDRDLYTGEEISYNIHMSTNSMDDPKYVSNNVYSGIDLINDTLSGNQHIDIYD
EVLKRKENELFGTNYKKNTSNNNVAKLTNSDPIMNQLDLLHTWLDRHRNICEKWNTKEEL
LDKLNEQWNKEKDGGNVPIDNRSLNTNVSFEIDMDDPKGKKEFSNMDTILDNIEDDIYYD
VNDDENPSVNDIPMDHNKVDVPKKVHVEMKILNNTSNGSLEPEFPISDVWNI
Download sequence
Identical sequences A0A0L1I611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]