SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L1I722 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L1I722
Domain Number 1 Region: 656-751,783-814,841-913,970-1128
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.16e-68
Family Duffy binding domain 0.00066
Further Details:      
 
Domain Number 2 Region: 220-320,353-579
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.19e-63
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 3 Region: 1121-1360
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.98e-30
Family Duffy binding domain 0.0054
Further Details:      
 
Domain Number 4 Region: 1-137,195-215
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.81e-29
Family Duffy binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L1I722
Sequence length 1984
Comment (tr|A0A0L1I722|A0A0L1I722_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:KNG74928.1} KW=Complete proteome; Reference proteome OX=580059 OS=Plasmodium falciparum IGH-CR14. GN=PFMG_00975 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKCATTSGKIQCNNHAPYDDYIPQRLRWMTEWAEWFCKMQSQEYDELMGKCGICMNGRCT
GVSGTCKKCEKACKDYKKKIEPWENQWNEISGKYLMLYLETQIAAANGGTHTYSGAVEPK
DEPVVDFLQELQKEIKNSDSKRPKRSAPGVTALTPNTPYETADRYIHQEIGNVGCNIQNE
FCFKKNGDTSSTATNNEKYAFMQPPKGYEEACGCKSRPKPPEKKEDKKDACEIVEGILNG
KSATSAIDGCNIKSDVNWECEKNIDPKYTGACMPPRRQKLCIHYLVDSGEKKKIKEPDNL
KDAFIKCAAVETFLSWQKYKEDKKKEKQIVEGVDILLDDEEEEDNLQNELNKGIIPEDFK
RKMFYTFGDYRDLCLGKDIGNDSGKDISGTVTSILSTKNGETQTTADDWWKTIEKEVWDG
MVCALSYSTDDKKEIQGVRDKLTGSKINYNYNSIKTNLKKFVKKPQFLRWMIEWGEEFCV
ERKKKEDNINDACSGNYTGDACNDAEHRCNKACKAYEDYVNKKKGEFQGQTNRFVQNASD
SKAHEEYEGYGYKAGEKIKQGNEYLLEKCDKRKCDCMDGDVGAVLPTDKPFGKYAFPKVK
ICNCLGGTHAPSAPPPAAQQPQPEAPQAPPTPPLPTVDACGIVAKIFEDTTTLQEACPTK
YVNGREKFPNWKCVSSGEKTTTTGSSGAICIPPRRRRLYVGKLHDWASDETTKRSKSLET
SDQKTPSGEKLRTAFIESAAVETFFAWHEYKEEKKREEKEQNEQNLGYKSSILENLQKQL
KEGKIPEDFLRQMFYTFGDYRDIVVHGGSNTNGDTKDGGDSSNNDNIVVLASGTKEEKDK
MEAIQKKIDEILEKSGNENSVKTVQSSRTAGPHPGISPSQNSVNDRQSLWETYAEPIWNG
MVCALTYKEDTSGEKDKPPEVDPKVKSALFKDGKKPTDNYTYDKVELKEDKNSGARTTGD
TSSPSGSNDPINNPKLSDFVKLPPFFRWLHEWGSDFCGKRARMLKNVKKACREKDNGDDT
FCSGDGHDCTENGKLKHKNMFADPDCPGCYEECRKYRKWIDMKFEEFYKQKSIYQAEHGK
LNGNSNGDNKEFCQQIKEKKTAADFLAALKHCKDGQNSGEKEYCKTCPPNEVTCNRGRRG
RRSGRNECSQNGQKWKDVFEGIIENGENSTTINVHMIDRRWPFIKNYLGKSQKLQKSKDS
NDLFKTSSLFKGIRKEQWKCKFNKEENTNVCKLDKFDQKVDLNEYTTFKVLLIYWLEDFI
EGYYILKKRKLIEQCTQKGENTCDENSKKNCACVKKWVEKKTTEWEKIKDNFKHRKPDDG
DTVVSKVRNFLQELIPRIAPTNDKGKVTELSDLERSLGCNCAERSEKEGGEDGTQKDIVQ
CLLKKLGEKANKCKDLPSDTECSQEQTLDLDDDDEPLEEEEEEKEKTNKQPGFCPPTPPR
PPEPEEEGGCITEVPKPDVKEEEEEKEEEKDKGVEKVPPPKKPEAPALPQPQPTQPDLSP
LKTALVTSTLAWSVGIGFAAFTYFYLKKKTKSSVGNLFQILQIPKSDYGTPTPKSKNRYI
PYASDKYKGKTYIYMEGDSSGDEKYAFMSDTTDITSSESEYEELDINEIYPYQSPKYKTL
IEVVLEPSGNNTTASGKNTPSDTQNDIQNDGIPSSKITDNEWNTLKDEFISQYLQSEQPN
DVSNDYSSGDIPLNTQPNTLYFNKPEEKPFITSIHDRDLYTGEEYNYDMSTNSMDDPKYV
SNNVYSGIDLINDTLSGNQHIDIYDELLKRKENELFGTNHTKKNTSTNSVAKNTNSDPIH
NQLELFHTWLDRHRDMCENWNNKEELLDKLKEEWENETHSGNKHSDIPSGKLSDTPSDNN
IHSDIHPSDIPSGKQSDIPSDNNIHSDIPYVLNTDVSIQIDMDNPKPINQFTNMDTILED
LDKPFNEPYYYDMYDDDIYYDVHDHDTSTVDSNAMDIPSKVQIEMDVNTKLVKEKYPIAD
VWDI
Download sequence
Identical sequences A0A0L1I722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]