SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L1I9M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L1I9M0
Domain Number 1 Region: 252-307,342-442,503-675
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.14e-70
Family Duffy binding domain 0.00064
Further Details:      
 
Domain Number 2 Region: 664-885
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.22e-43
Family Duffy binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L1I9M0
Sequence length 1492
Comment (tr|A0A0L1I9M0|A0A0L1I9M0_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:KNG76197.1} KW=Complete proteome; Reference proteome OX=580059 OS=Plasmodium falciparum IGH-CR14. GN=PFMG_02467 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKINCINILLISVSLNILVNTHKKTSITPRHTPKIQTTRLLCECELYSPANYDSDPEMKR
VMQQFEDRTTQRFHEYDERLQSKRMQCKEQCDKEIQKIILKDKLEKQMVEQFSTLQTDIQ
NDAIPTCICEKSIEDKVEKACLRCTQNLGGIVAPSSGVLLGIAEGALYAWKPKALEAAIA
AAKEAGVATGLLEGIEAGKKAVMGALKEYFFTETLGINSLDSYFTKGYYFDIENLATVIL
ERRDAASAVTTTRSSGAICVPPRRRKLYLHDLKTLGEADKTPTDTQLLEWFVKSAAVETF
FLWDRYKKLNTKKTQGDGSQLLPLLYGSSGDDNNPQTLLQNGTIPPDFLRQMFYTLGDYR
DILVRGGDTNGGNNIILNASGNKEDMDKIQKKIDEILNGDNNQKSGHPPSSEKNSGLTRE
TLWDRIAQPIWNGMICALTYTDSEQKGGTPTQDGEVKKAFFGDKDNPVTTSTQKGTFTTT
YNYKTVTLKDESSDTNPQTTSPASEKTPLDSFIKRPPYFRYLEEWGQNFCKERTKRLKQI
KVDCKVDEKGKNYCDGDGFECTQIVKNEETNIKTFDYPSCAISCRNYKKWINKKRTEFEK
QKDRYQTESNSAKRNNDYSGFHTTLKTCLTTGDFLERLKNGPCKNNNDNGEDEIDFKEKD
GKTFQHTEYCDPCPQFKVKCNRNGECNGEKKEKCDGRTAISVNDIENKGDSTQEVTMLVS
DDSATGFAGGLGDCKSSGIFTGIKEHKWKCGKVCGLDVCGLKSDNEKNNEQIILVKTLLK
RWVDNFFDDYNKIRKKLKPCINNGEEDKCIKRCKENCECVKKWLQKKREEWKKIKKRYIE
QYKNNYGDAYNVRTFLEEFLSQTEVLKATGSCTTLDAFEKSKECTETDSSENEKDKGSNK
KDGVLCLLENLKTKATSCPGKTSDDTQAACVEKSAPVEDDEEDLLLEDENTANTAPNICP
QPQLPQEDESGCKPAAPQPDVKEEEEEKEEEKDKGDEEEEEEEAEEEEEFYEEEEAEEEE
SVSDSYDDSDSETEDEHQNEDVTDTSSHSESQPKQLTREFPSTQLKNAMLFSTILWMVGI
GFAAFTYFFLKKKPKSPVDLIRVLDIHKGDYGMPTLESKNRYIPYASDKYKGKTYIYMEG
DSDSGHYYEDTTDITSSESEYEEMDINDIYVPDSPKYKTLIEVVLEPSKRDTFNAPSGNT
PSNDIQPTNRFTDEEWSELKHHFISQYIQSRLPLDVPKVGVSTELPMNIVGNVLHDGMHE
KPFITSIHDRDLYSGEEISYNIHMSTNTNNDIPKYVSNNVYSGIDLINDTISGDRIDIYD
EVLKRKENELFGTNYKKNTSNNNVAKLTNSDPIMNQLDLLHKWLDRHRVMCEKWNTKDEL
LDKLNEEWNKDNDGGDIPNDNKKLNTDVSIEIDIDENKGKKEFSNMDTILDDMEDDIYYD
VNDDENPFVDDIPMDHNREDVPKKVHVEMKILNNKSNGSLEQEFPISDVWNI
Download sequence
Identical sequences A0A0L1I9M0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]