SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L1IBN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L1IBN7
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000000000000523
Family Duffy binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L1IBN7
Sequence length 701
Comment (tr|A0A0L1IBN7|A0A0L1IBN7_PLAFA) Erythrocyte membrane protein 1 {ECO:0000313|EMBL:KNG76630.1} KW=Complete proteome; Reference proteome OX=580059 OS=Plasmodium falciparum IGH-CR14. GN=PFMG_02859 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
KCDCGKKCDCGKKCDCGKKCDCVKEWIEKKKEEWGKIKERFNDQYKNPDNYNVRSVLEEL
IPQIGAAKDKDKVIKLSKFQGSKGCCASASSTNGKDDAIDCMIEKLEKKIDQCKQKHALP
SGVEQCITLPTTVEDDEEDLLVEETEENQVAQPNICPEIKPEPEKEEGDCNPAPTEPKKP
AAESEEQIPVPKPEEEAVPEPDVTPNKEETSPSSPTLSDERSKPIGDILSSTIPFGIAIA
LTSIVFLFLKKKTKASVGNLFQILQIPKSDYDIPTKLSPNRYIPYTSGKYRGKRYIYLEG
DSGTDSGYTDHYSDITSSSESEYEELDINDIYVPHAPKYKTLIEVVLEPSGNNTTASGNN
TTASGNNTTASGKNTPSDTQNDIQNDGIPSSKITDNEWNTLKDDFISNMLQNQSNDVPND
YKSGDIPMNTQPNTLYFDNNQEKPFITSIHDRNLYSGEEYSYNVHMVNSMDDIPINRDNN
VYSGIDLINDSLNSNNVDIYDELLKRKENELFGTNHTKKNTSTNSVAKNTNSDPILNQIN
LFHTWLDRHRDMCEQWNNKEELLDKLKEEWENETHSGNTHPSDSNKTLNTDVSIQIHMDN
PKPINEFTNMDTYPNQVDDTYVDSNPDNSSMDTILEDLDKPFNEPYYYDMYDDDIYYDVN
DHDTSTVDTNAMDVPSKVQIEMDVNTKLVKEKYPIADVWDI
Download sequence
Identical sequences A0A0L1IBN7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]