SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L1IG70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L1IG70
Domain Number 1 Region: 51-320,350-386,417-476
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.19e-83
Family Duffy binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 793-1143,1200-1218
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.37e-76
Family Duffy binding domain 0.00016
Further Details:      
 
Domain Number 3 Region: 1635-1757,1789-1812,1847-1915,1979-2028,2052-2120
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.1e-66
Family Duffy binding domain 0.00081
Further Details:      
 
Domain Number 4 Region: 1225-1326,1359-1585
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.79e-63
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 5 Region: 506-665,697-717
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.15e-36
Family Duffy binding domain 0.0033
Further Details:      
 
Domain Number 6 Region: 2096-2260
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-21
Family Duffy binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L1IG70
Sequence length 2262
Comment (tr|A0A0L1IG70|A0A0L1IG70_PLAFA) Erythrocyte membrane protein 1 var IT-ICAM {ECO:0000313|EMBL:KNG78240.1} KW=Complete proteome; Reference proteome OX=580059 OS=Plasmodium falciparum IGH-CR14. GN=PFMG_04463 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAPQKPTAPDYNNVNNAKDLFDEVGKYIEKKVRGDAQQYFSELHGRLSEATFEGNKISGS
PPCDLDYTKLTNVTTGFGKEYPCENRSNIRFSDVRGGECADSKIKGNKGSYGGACAPLRR
LHLCDYNLENISDFDNINNHTLLVDVCLAAKHEGELLKGYHDIYKETNRGSQLCTVLARS
FADIGDIIRGRDLYLGNKKEKDRLEENLKKIFQYIKNKNKSTLESLTDEEIREYWWALNR
QDVWKAITCEAGNDSQYFRQTCVGGSPTQGKCLCADTDVPTYFDYVPQYLRWFEEWAEDF
CRKKNKKLKDVKTNCREQDKYGNERYCDLNGFDCERTIYKKGYFVIDKDCNTCSVWCRMY
ESWIDNQKKEFLKQKEKYTKEITSGGASGVPSGNGMTKGGAGGISTKVYDGYEKKFYEEL
KKGDYGTVDKFLNLLSKEKECENIKDTEGGGKIHFNNTDNKDNKTFYHSEYCEECPECGV
KREGNRWENKQDGPECTVESTFNPLNPKDITKINVLYSGKGRGDITEKLKDFCEKPHKED
GEKNEQWECYYKDVTEDKCRMKKAGANDQGHDKIMSFNDFFNFWVGHVLNDSIEWRKQLT
KCLSEDKLKKCEEGCKSNCECFKKWIEKKEKEWEKIKEHFKKQEGIPGGWTHYNLLETIL
EYYYFKNIQKAYGDLKSIQEMKKMIEENKENKNRTKGDVDALDVLFDHELEEAEDCLDIH
EDDDECVEESEQIPNNPCSGESGGSGSSSVLRRYPAVATKVAYEMHKAAKTQLRNRAGGR
KTLRADASKGHYSRGGSGDDFKDICKITKNYTNDSRSAPNGEPCTGKDKPGVRFEIGTEW
SNIEGKKQTSYKDVFLPPRREHMCTSNLENLDVGSVTKEDKASHSLLGDVLLAANKQAED
IKKKYQENKRSSGQNEKNAKNGLTDKKTVCRAMKYSFADIGDIIKGTDLWDQNSGEKTTQ
GNLVKIFEEIKGTLTDDIQKKYKKPDGKHKQLRADWWTANRRQVWRAMKCATKNGNIQCG
ATPYDDYIPQRLRWMTEWAEWFCKMQSQEYDELMGKCGICMNGRCTGVSGTCKKCEKACK
DYKKKIEPWENQWNEISGKYLMLYLETQIAAANGGTHTYSGAVEPKDEPVVDFLQELQKE
IKNSDSKRPKRSAPGVTALTPNTPYETADRYIHQEIGNVGCNIQNEFCFKKNGDTSSTAT
NNEKYAFMQPPKGYEEACGCKSRPKPPEKKEDKKDACEIVEGILNGKSATSAIDGCNIKS
DVNWECEKNIDPKYTGACMPPRRQKLCIHYLVDSGEKKKIKEPDNLKDAFIKCAAVETFL
SWQKYKEDKKKEKQIVEGVDILLDDEEEEDNLQNELNKGIIPEDFKRKMFYTFGDYRDLC
LGKDIGNDSGKDISGTVTSILSTKNGETQTTADDWWKTIEKEVWDGMVCALSYSTDDKKE
IQGVRDKLTGSKINYNYNSIKTNLKKFVKKPQFLRWMIEWGEEFCVERKKKEDNINDACS
GNYTGDACNDAEHRCNKACKAYEDYVNKKKGEFQGQTNRFVQNASDSKAHEEYEGYGYKA
GEKIKQGNEYLLEKCDKRKCDCMDGDVGAVLPTDKPFGKYAFPKVKICNCLGGTHAPSAP
PPAAQQPQPEAPQAPPTPPLPTVDACGIVAKIFEDTTTLQEACPTKYVNGREKFPNWKCV
SSGEKTTTTGSSGAICIPPRRRRLYVGKLHDWASDETTKRSKSLETSDQKTPSGEKLRTA
FIESAAVETFFAWHEYKEEKKREEKEQNEQNLGYKSSILENLQKQLKEGKIPEDFLRQMF
YTFGDYRDIVVHGGSNTNGDTKDGGDSSNNDNIVVLASGTKEEKDKMEAIQKKIDEILEK
SGNENSVKTVQSSRTAGPHPGISPSQNSVNDRQSLWETYAEPIWNGMVCALTYKEDTSGE
KDKPPEVDPKVKSALFKDGKKPTDNYTYDKVELKEDKNSGARTTGDTSSPSGSNDPINNP
KLSDFVKLPPFFRWLHEWGSDFCGKRARMLKNVKKACREKDNGDDTFCSGDGHDCTENGK
LKHKNMFADPDCPGCYEECRKYRKWIDMKFEEFYKQKSIYQAEHGKLNGNSNGDNKEFCQ
QIKEKKTAADFLAALKHCKDGQNSGEKGIRKEQWKCKFNKEENTNVCKLDKFDQKVDLNE
YTTFKVLLIYWLEDFIEGYYILKKRKLIEQCTQKGENTCDENSKKNCACVKKWVEKKTTE
WEKIKDNFKHRKPDDGDTVVSKVRNFLQELIPRIAPTNDKGK
Download sequence
Identical sequences A0A0L1IG70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]