SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L6JXV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L6JXV2
Domain Number 1 Region: 246-396
Classification Level Classification E-value
Superfamily CYTH-like phosphatases 3.27e-28
Family CYTH domain 0.0000925
Further Details:      
 
Domain Number 2 Region: 141-196
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000288
Family Type I dockerin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L6JXV2
Sequence length 401
Comment (tr|A0A0L6JXV2|A0A0L6JXV2_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:KNY30262.1} KW=Complete proteome; Reference proteome OX=398512 OS=Pseudobacteroides cellulosolvens ATCC 35603 = DSM 2933. GN=Bccel_5539 OC=Pseudobacteroides.
Sequence
MIKLKRSIMLVLVCLLLFQPTMITNVEGVEEVYAETTLQDVEKMPPPTFVVQGSIKTDVD
CSQEAAKLVNAGFTISFGTFKTTSDERGNFYGSFRNFKSTFKEDMIIEKPGFLKRTIKGV
ELQANSTTYYNNIYILPGDIDGDSSINIADCVYLAKMFNSIKGDNIYSADADINKDGAIN
LSDFVYIAKYFNMTSAAYPPYRPIDSTPTPVTATPSSTTPTPTQVVTPTPTPIVSTTPTP
DLSGLEIERKFLIDKSKIPYDLSTLDKYELEQAYINFSPEIRIRKADDWMFFLTVKAYVD
DMAMTREEREFWITEQEYNILMKKIEGNIIYKTRYQGLDENGVMFAIDIFKGNLAGLAYY
EIEFPNEEEANKYTPPAWIGKEVTNDKRYKNGSLAQFGIPQ
Download sequence
Identical sequences A0A0L6JXV2
WP_050753919.1.39137 WP_050753919.1.73063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]