SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L6UWF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L6UWF2
Domain Number 1 Region: 208-301
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000047
Family Thioltransferase 0.058
Further Details:      
 
Domain Number 2 Region: 410-527
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000336
Family UBX domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L6UWF2
Sequence length 570
Comment (tr|A0A0L6UWF2|A0A0L6UWF2_9BASI) Uncharacterized protein {ECO:0000313|EMBL:KNZ52582.1} KW=Complete proteome; Reference proteome OX=27349 OS=Puccinia sorghi. GN=VP01_3512g1 OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MNSDTLDDEAISSYLSFTNTSDIQAARNALQLANGNLEAAVEAYLDSNSHPTSSLLPNHE
RPYEQLSLDDSSQSDRHLLPATPSTPHLAGRPRPSRAFEPSPRPRRTNSKILGFFLRLCI
GPFRLIAIPVSFVADLGLTIFSLLGRLLGLRLPTMSFHWPRVSSFSWGGATPRTDPRTAA
ERWVRDLEEELHALSSYTTAQAGDPAMPRLPEFLLLGYDDAVQKAREELKVLMVVLVSEE
HDDDHQFKRGTLMDEELLNLLRTKDILVWGGDVKERDASFAAHVLDATTFPFVAFVSLQA
KRPSSTVTTITSNVNRSSSNIMSVCTRLEGSPLHTTSSRSLCTTVNSVVIPRTTGYLSRL
RAEKARREADRRLREEQDRAYAEAGRLDRERVMRKKAEMEAERKRQEELKLKELERERVR
REKLEEGEQKRRWRYWTRREKMPPEPAATDGVTVGFRLGDGRRVVRKFRADAPLEALYLF
VELESAPRTDEDATAAALPRPRPGYHHTYSFRLSTAMPRRILPVPDSTPSATEHISIAQF
GGLDGANINVEGSVIEPSSDEEEEEEEEDN
Download sequence
Identical sequences A0A0L6UWF2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]