SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L6WJK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L6WJK8
Domain Number 1 Region: 143-208,235-296
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000942
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L6WJK8
Sequence length 679
Comment (tr|A0A0L6WJK8|A0A0L6WJK8_9AGAR) Glucan synthesis regulatory protein {ECO:0000313|EMBL:KNZ75508.1} KW=Complete proteome; Reference proteome OX=1306850 OS=Termitomyces sp. J132. GN=J132_02842 OC=Termitomyces.
Sequence
MGWLSSFFSSADSSQYSRKGQALSSTHEAFSLPTSSPTFSHPHPDAFDPDTLHTPDLEAS
MNTVYTYPPQGRGSYGYVHTFAGLSSRPASASLLPSHHDRHHTSLSPTSSFPPLASSWNR
IRAWLHREYPELGDTLNYGILPLDLSQIEMQFGFALPPVIRESYLCCDGQEAESAAGCSE
GLFFGLKLLPLEDVLQEWKFWREVDGDPATGANPRLREAMQSIPPGWIRKEYSQRGWIPL
IADKVGNYIGVDLNPDESGSVGQVIIFGRDFDTKVVLWRGDGPGGWAKWLASFAEELESG
EGFEIGSGDTSDDSEDDLGYESYFYDGTGRGQGDGGGDTGNSGLRLTGEYRGWNVLEAWA
DRSLRRWHDAGVITDISLLPLEETKEPEPEVLNIRHESSVDVGIPILTDGDAPIPAPASI
PELEQLPHSASLPSISVTRPPVPIPVELPQPSDIFPDSPPESLPSSFDEDLESGRSIGRR
EVSDFVSRRPSPREHSNSNASSNTSISALVVPQQLQTSLSDTDERPTSPPASHVQTNVPD
LLADSAPSLYTRPIAPLSPGSAKASASSATPIQEPSLDDEKKPAAAAITQEGGEPDNTVR
LVGGGGVVGIAKPEEKEDKARVGSSEDVASDAASSDSAASSAKAHKKTKSSLASLKKLGL
GLKRNSTSSLKGMESSIAT
Download sequence
Identical sequences A0A0L6WJK8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]