SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7KBC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7KBC8
Domain Number 1 Region: 97-510
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.14e-79
Family Duffy binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 913-1020,1061-1174,1248-1415
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.05e-72
Family Duffy binding domain 0.00067
Further Details:      
 
Domain Number 3 Region: 1742-1936,1964-2121
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.11e-63
Family Duffy binding domain 0.00024
Further Details:      
 
Domain Number 4 Region: 2126-2446
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.59e-63
Family Duffy binding domain 0.0000374
Further Details:      
 
Domain Number 5 Region: 1404-1627
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-38
Family Duffy binding domain 0.0028
Further Details:      
 
Domain Number 6 Region: 501-751
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.71e-35
Family Duffy binding domain 0.007
Further Details:      
 
Weak hits

Sequence:  A0A0L7KBC8
Domain Number - Region: 752-769,841-868
Classification Level Classification E-value
Superfamily ARM repeat 0.0219
Family MIF4G domain-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L7KBC8
Sequence length 2555
Comment (tr|A0A0L7KBC8|A0A0L7KBC8_PLAFX) PfEMP1 {ECO:0000313|EMBL:KOB60663.1} KW=Complete proteome OX=137071 OS=Plasmodium falciparum (isolate HB3). GN=PFHG_02423 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSTPGGRQGDGGEDIDHQSAKHLLDSIGKKVHDEVKNGEAKTYDSYLKGDLNKANNSSDE
TIGSIETCNLVKQYYEHFNGDASDKRQPCKKDGTGNDVDRFSDKEGAQCDKKKIKDSDSN
GGACAPYRRLHVCDKNMVKMDTIKNDSKAKHDLLAEVCMAAKYEGESITRYHPQHQVTYS
DSAAELCTVLARSFADIGDIVRGRDLYRRDSRTDKLEENLKVIFGNIYKELTSTNGKNGK
KDAEERYKGDEANNFFKLREDWWTENRETVWKAITCDAHGTYFRATCSDSHRSETFSQAK
DNCRCDGDQVPTYFDYVPQYLRWFEEWAEDFCRKKKKYVDIVKTYCRGKDKDGKKRYCSR
NGFDCEKTKLAIGKLRYGKGCTDCFFACNPYVHWIDNQRKQFDKQVKKYKTEISDGGRSR
SRKKRSTKSETYEGYEKKFYEKLKESDYGKVDKFLEKLSKDKECEKVKDTEGGRINFKQV
NSGSASDSGTNVESQGTFYRSKYCQPCPICGMKKNNNGEWEHKKNGKCTSGKLYEPKGDA
EGTPIRILKSGEGHEDIKKKLNAFCQEQNRSDGSSSSGVAGGGKNSNNQELYEEWKCYEG
KHVQKVNNGEEEDDEEDVEEVKKAGGLCILKKEKKGVEETNSQKEPDEIQKTFNDFFYYW
VAHMLKDSIHWRTEKVKGCLKNGTKILCKNGCHGKCDCFLKWVGKKKNEWKAIKEHFRKQ
DISATVGNDNSASLIAFNHDDVLQQVLNKDLLLTSLREAYGKPEDIKHIKQLLDEEETAA
AGETDNKNNTTIDKLLQHEDKDAKECLQKQNDCNKQSPPAGDGGGVGRSLGPISRSEDEP
EENHSDEDEDDDEDEDDDEDEDDEDDSDDNNEVEETETEAAKESEPPASQEDGVKPCEIV
KTLFEKPESLQAACSLKYGPKAPTSWKCVTSSGSDEKSGDKDGAICIPPRRRRLYVGKLH
DWACDEATKGPTSPQTSESSQSSSSSSTPPPSNSRDVDGLLKAFVESAAIETFFLWDRYK
KLNTKNKGETQGVSSLPTLSGESIPTESDDDQPPDKQLLEGKIPDGFLRQMFYTLGDYRD
IVVRGGGDVNSGSEKEGDSSNNNNIVLLASGTKEEKDKMEAIQKKIDEIIKQSGTSGPSS
VKTGSNSGTDPASLWDRIAQPIWNGMVCALTYKETSGSDKPQVNDSLYKKFFGENSESKD
GKPVPQPGTTSTQNGTFESTYKYDQVELKEEASGAKTVGSSSHSGDDPLNNPKLSDFVKL
PPFFRWLHEWGSDFCGKRARMLKDVKDNCMDDSGKKQKCSGDGLNCKDTVPDNDKIFHDF
NCQSCITPCRFYKKWINTKRDEFNKQSNAFTKQKTDAQKNNGDNGFCETLTKYTTAKEFL
QKLGSCSKTNNGGSEITFDDSGDTFKPAENCKPCSEFKINCQNGNCGADTNGKCNGKTPI
AATEIAKMITSTEGVFMTVSDNSDHKFDDGLEACENAGIFKGIRKDVWKCGEYCGVDICT
LEKKIKNGKESDEHIIMKELLQQWLEYFFEDHNKINKKLKPCIENGEKPKCENKCEQKCN
CVKKWVEEKKDEWDKINGTYLKKYKSEDDGSNNLNSFLETLIPRMDLVNDKGKISDLATF
KTLYGCNGTDSSQKDIIECLLNNLQNEINKCLSSTSGSEQCTTPPSNLDDDDTPDEPLDD
YYIQQPNFCPPPPPPMTCVEEIAKKLREDAERAVEKMKDNKLKGDGTKFNGACNKVKKEN
NGGNVKDACDFEKTYKTSVKSLKETCKDNRKEPFKIGQKWNSKYIKKIRKHLYIPPRREH
MCINYLKEISRYTDTDSNSLLKKIQEAAQHEGDDIIRKILEENSCDEHRICDAMKYSFAD
LGDIIRGRDLWNTNRKEQGIQRKLENSFENIYNKMGNDKNKYEKDRPKYLQLRSDWWDAN
RKHIWNAMTCNAPKDAKLNKRNEEPEGTSTNGSFVSTLDNCGYEKDPPNYDYIPQPFRFM
QEWSENFCKLLNEEIKKFETQCADCKNNGFSCEDDRNGTNCENCKNQCEKYKKLIHNWKL
GFDKYKEAYKEIYNNNAKISSEEYVKNFLEKLKAQCPGKDSADKYIDEATHCTKYKFSNS
ENKNHNNYAFKSPPKEYERACECEAPDPLDQCPHTVESKLTCTKLSITSECWKKYYNNDL
DSWDSTSVEDFTGKNKGVLVPPRRRYLCLRNITSNLSSIKSKEDFKKKLIEAAFNEAYSL
SEKYKDQEKAFPALKYSFADYGDIVRGTDLISTINLIDLNGKLNDFFTTDGINNVRNNRD
KWWNENKEHVWHAMVCGYQKSNDYKSINASWCTLPDEDKTHQFMRWFREWTESFCNYRKK
LYDIMVNNCNEARCDKITGKVDLYECTKACTEYENYVSKKKNEYFSQKQKYDKDFKDSYN
NKDAPNYFKYNFFVNNYDCLFDNFKDENNWKNPYDSFDDTKNKEKCECIQLIIPTKRKEK
EEPKKPVRPPLPPTPPKRKPKQREIHHNILPQMLSISAFPLSVGIAFASLTYFVLKVILL
CAYVLCLYIYMCIYIVGVDICILYIYVFILKKRKK
Download sequence
Identical sequences A0A0L7KBC8
PFHG_02423T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]