SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7KCS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7KCS8
Domain Number 1 Region: 73-352,375-457,492-511
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.19e-81
Family Duffy binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 907-981,1013-1280
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.32e-65
Family Duffy binding domain 0.0012
Further Details:      
 
Domain Number 3 Region: 2013-2313
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.62e-63
Family Duffy binding domain 0.0000304
Further Details:      
 
Domain Number 4 Region: 1647-1985
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.23e-59
Family Duffy binding domain 0.0000933
Further Details:      
 
Domain Number 5 Region: 504-600,627-744
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.8e-34
Family Duffy binding domain 0.003
Further Details:      
 
Domain Number 6 Region: 1272-1474
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.28e-33
Family Duffy binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L7KCS8
Sequence length 2833
Comment (tr|A0A0L7KCS8|A0A0L7KCS8_PLAFX) PfEMP1 {ECO:0000313|EMBL:KOB60659.1} KW=Complete proteome OX=137071 OS=Plasmodium falciparum (isolate HB3). GN=PFHG_02419 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVVYTNSSRTINKKTKTGPHVGHRRGGTQVDGVKDLFDKIGRTIQQEVHKAAKTYTSELH
GDLSKATYKNDKNPEGTTPADPCLLDHSLHTNVTIGGDKEYPCEKRSNVRFSDKEGAECN
KSKIKDSKTNCGACAPYRRLHLCDRNLENINDYSKINNKDNLLLEVCLAAKYEGDSIIGE
YPNFQNKYGDSGFTTCTMLARSFADIGDIVRGKDLYLGDNRKDREQKQKLQENLNKIFND
IKKNNQSKLGRLSLDQIREYWWEENREKIWKAITCNAWGNTYFRGTCSNDTTSAKNNCQC
IGGTVPTNFDYVPQFLRWFEEWGEDFCRKKKKKLENVQKQCRGEYQGEERYCSRNGYDCE
KTVNARGKVRMGKGCTDCFFACNPYIDWINNQRKQFLKQKERYDNVINGTSRSSRKKRAA
TTSNYEGYESKFYKELQSKNVGNLDNFLELLNNEKACQAVIDNDGGKINFKEVNSGGKNS
SGNGVFSGDASGTNDENKGTFYRSKYCQPCPLCGVQNKGNKEWKEKNNDNCKNIKLYTPK
NGQHGTKIEILKSGEGKKDIEKKLNAFCAEKNGDTTNSGGSVGGRNSNSSLYDPWQCYEG
KDVEKVKDGNDEDDEDEEDYDNDVKTGGGLCILKNENKKEQSEANSQNEPKEFQKSFFDF
FYYWVAHMLKDSIYWRTKKLKGCLENGTKILCKNGCHGKCDCFLKWVGQKKKEWDKIKEH
FYKQEDFNNEGDLGEGMTPDFVLEENLKSEFYKEDSEEKSAEDNQNSLDAQEAEELKHLQ
KILKQDEQNTQEADAAPDGKKKTIMDKLIEHEEKDAKQCIEKHTCPPPEDTSRGRSLPPA
GAGDDEDEDDEEDDEEEEVENHTEEEPHDHDAECKCHENVPTSPPDACEIADAILTREGA
TNYIDVCKQKYDGGKKSYPGWNCNSSTFKDKEDGVCMPPRRQKLYVHNLKNLNDKTPPDQ
LRKAFIECASIETFFAWHKFKKDKEKKEQDLGGFASFDNEDTLPQPDDELNGGTIPEDFK
RKDIGSDMDAVNTNIDNVFKNDAQTDGKKLDEKRKQWWEKNAQAIWKGMLCGLSYASEKN
DTVQTQLTNKYDYNNVTFKGGLDGDTKLTDFVTRTPYFRWLEEWGDEFCRKRKDKLTKVE
KECDGVNENGNKIYCSGDGYDCMGKDLSHNNIYADFNCRGCEKECRNYKKWIVNKRNEFD
KHRNKYKKEFQELSTSFNNEDDQKFYESLRKKGYSSVENLLASFNQGKECQGNSNPKKNT
DFNKVLETFSPSTYCKACPLYGVNCGGKGGCQNNKKKVQHNTKGVSTYIPVLLNDDATKD
NDEYLEQNCTKYGLYKDLRIQEWKCQYLNEVDQCNINKDVKTEYFDNEIPFNVLFERWIK
DFIQDYNKSKAKISSCIKNEDERDSTCIKGCKNKCDCVEKWVDKKVKEWEKIKEHYNKQT
ERYIYDVAYKVKNFFEKPPFNTYAEEAKKIFDNEMKEDDIWGCTGNITCETEEKKIKYGD
FIANLISELRKKIESCNMQHDKAQENCNTSPTNDEGFQEVQEDEDQDLSPAPEICKDVIP
KSAKPEKPVETPMSCVEKIAKQLREKAERSVKHNDSSLKGNGTAFDGECSKLKKDDDGVN
GENACNFEKTYKNSLNNINNQCEHKGMDRLKIGKNWNCVKIKKIGKYLCIPPRREHMCLD
DLKILGRSTINDSSDLLKKVQQAAKHEGDDIIKNLLPENPYLGDIIRGTDLWNKNIKEQK
LQIRLGNAFENIYKNLDDNTKTNYKKEIPHYYKLRSDWWDANRKEVWKAMTCNAPDASKF
LKKDPNGSSGKLLSSTNGISVGHKKCGYGKYPPDYDYIPQPFRWMQEWSESFCKLLNKEL
DNFKNQCSDCQTNNSICTTNVEKCKSCKEQCKNYKELIDQWKNQFDKHKEIYKEIYNNKD
SSKSKEYVTKFLEKFKSECKNLDTADKYLHEATQCTDYGFLESDKDDEKYAFKEIPKDFE
QACKCEPPDPLDHCPNTEENKGACNNISKVMLCQKKIYNNYRDNWDSSNVEDFTGKNKGV
LVPPRRRYLCLRNITSNLSVIKTKEYFKKKLIQAAYSEAYFLSEIYNKDQEKALQAMKYS
FADYGDIAKGTDMIENSNKKKLNTKLDELLNDATNNNPPAYREKWWEENKQHVWHAMVCG
YQKGNNYKPINSLWCTVPHEDEKTHQFMRWFREWTESFCAQRKKLYDIMVAKCKEAECDK
TTGRMSMYGCTQACREYENYVFKKKLEYFGQKEKYDNEFKALNDNKDAPYYFRSTFFSKN
YDCLFDNFNGDNKWKNPYESFNNDEYKEKCECKQSVIPTERKEQKTDKDPEESPQKPVPD
PGPSPEKSPPKSDVLPPSQSDESSIPMNDILSTTIPFGITITLGSIAFLFIKKKSKSTVD
NFIQILEIPKGDYDIPTLKSSNRYVPYGSRSKRSFDPVTKYKGKTYIYMEGDSGSDSGHY
DEDTTDITSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSKRDTFNILSGETSNGDIHT
NKFTDDEWNQLKQDFISQYLQNIQNDLSNEKTIDDNMYKYSHPNTLYFDNPDEKPFITSI
HDRDIQNGEEVTYDINFDVPIIINRTTNTTDDPKYVSNNLYTGMDLINDSLHGNNNVDIY
DELLKRKENELFGTNHTKRTTTNSVAKNTNSDPISSQLNLFHKWLDRHRDMFEQWDKNKK
EKLLDKLKEEWGKENYNNSGDIHSKCVNVLNTNVSIQIDMDDPKPINEFTNMDTNPEKNT
MDTIFDDMEKDREPYYNDIYDDDMIYYDVHDNEPSIDDIKMEVPNKVQIEMNVVNNKKDL
LEEEYLISDIWNI
Download sequence
Identical sequences A0A0L7KCS8
PFHG_02419T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]