SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7KHG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7KHG9
Domain Number 1 Region: 55-285,320-363,393-511
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.28e-86
Family Duffy binding domain 0.00028
Further Details:      
 
Domain Number 2 Region: 852-903,936-964,1005-1027,1065-1182,1217-1395
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.28e-74
Family Duffy binding domain 0.00075
Further Details:      
 
Domain Number 3 Region: 1773-2079,2106-2125
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-68
Family Duffy binding domain 0.0000544
Further Details:      
 
Domain Number 4 Region: 2126-2446
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.05e-59
Family Duffy binding domain 0.0000471
Further Details:      
 
Domain Number 5 Region: 504-722
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.06e-31
Family Duffy binding domain 0.0041
Further Details:      
 
Domain Number 6 Region: 1400-1625
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.89e-31
Family Duffy binding domain 0.0092
Further Details:      
 
Weak hits

Sequence:  A0A0L7KHG9
Domain Number - Region: 2623-2652
Classification Level Classification E-value
Superfamily Adhesin YadA, collagen-binding domain 0.00105
Family Adhesin YadA, collagen-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L7KHG9
Sequence length 2967
Comment (tr|A0A0L7KHG9|A0A0L7KHG9_PLAFX) Uncharacterized protein {ECO:0000313|EMBL:KOB62541.1} KW=Complete proteome OX=137071 OS=Plasmodium falciparum (isolate HB3). GN=PFHG_04057 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAVASGGGEDGIDKRSAKHLLDSIGKIVHDEIVEKAEAQTYKEALKGDLQHATNINPELI
DNIETCDLVYKYYKHTNGGDARGKRYPCENLSGKYVERFSDTLGGQCTNEKIKGNKYIER
QDVGACAPYRRLHLCSHNLEKMEANNYDSGNAKHNLLVDVCMAAKYEGDSIKNYYPKYQR
TYGDSPSQICTMLARSFADIGDIVRGKDLFYGNPQEKEQREKLDEKLKEIFKKIHDNLVE
KKGNEAKDRYKDEPDNNFYQLREDWWMANRDQVWKAITCKADNSNRYFRQTCGSGEKGSA
TTGKCRCSDKPKSGKPGDVSIVPTYFDYVPQYLRWFEEWAEDFCRIRKHKLEDAIKKCRE
KVKEDKKLYCDLNRHDCEKTASGKHDFFVEDDCKYCHFSCSHFVKWIDNQKVEFLKQKKK
YDKEIKKANGKNGTSITIGKTTINNIYAKEFYKKLKRAKYKDVETFLGKLNEEGICQKPP
EVGEEKADHVDFTKNKIDKTFDHTTYCQACPWCGAEPKSGGGWIAKDDKTCGEGKDYTKY
KKTEIPILTGDKTKSDMVKKYKKFCDSVNGEKGAPGTANGGGQIKKWECYYDEHETSSKK
NNNCVEGTWQNFRGKQTVKSYNVFFWDWVYHMLHDSLDWRNELDNCLKNENKQCIIKCNR
KCDCFLKWVKQKEQEWGKIKDHFGKQKDIVQVGGFLGSLFSSPDFVLEEVLKDGNLLQNI
KDVHGDTDDIERIEALLKETGVAASGVSGIGGATGKNTKIDKFLQEELNEANRCKNCQET
QKPGGDGAVARSDSASPDQQPQTPAQEDEEDEEEEEEEDDDNGAEDKDHQEDATVDVDEE
AAKETTENQEDKTPKVEVEGKPACDIVKELFKDTSKFKDACDLKYNKGKNYGWRCVAPSG
DKTGTISEGSGVGDRGALQRNKRDTDLSVTPTSDKGSICVPPRRRKLYVGKLEQWAESKQ
VGNTQGGSDSSQGTTEGSKSPQAVGGQATLSAASTETPESSLLRDGLREAFVESAAVETF
FLWHKYKVDKKKEEEEKEERERENGGFGHSGEDDDPKPEDELKSGTIPNDFLRLMFYTLG
DYRDILFSGGITGDSSSDKDSSSSNHEKNLVVLLSENKQDMEKIQKKIDEMIKQGENKES
AIGGPKSLSVTHTQPSDKLTQWWDKIAEHVWKGMICALSYNTENITKDEDVHTKLMGATK
TIYKYNTVTISSVPSGDITLDDFASRPTFFRWLEEWADEFCRKRTHKLAQIKHECRSDKP
GHQYCSGDGHDCTNNDRNYNNMFADLFCRPCYEQCRKYKNWIDMKFEEFHKQEKKYEEEH
GKVIACSKNGGDDDNTKFCQQIKEKKTAADFLAALKHCKDGQGGEEKKSNDQDNKINFND
PKTTFGPLDYCKTCPFNGVNCNGSGRGRSNGCNVNGNGETWEKVFGTISENGENTTEITV
EMIDRRASFIKKYLENSQKLQKSKDSNDLFKTSKLFKGIRKQEWECRFKEEKIDVCKLTN
FNNEIDLNPYTTFKVLLHYWLEDFLYGYYILKKKRIIDLCTKNGGNTCDKEPKIDCVCVK
TWVEKKKEEWEKIKNHFKNRNQKDGDNIMSKVKNFLEELIPRMDLVNGKGKINELKEFLM
SYGCNGTDSSQKDIIQCLLNNLQNEIKTCETQSNCDTLPPSVENLTIVEDIDPDDQDTQI
DIVPGVCNTVVKPTPPEPPMTCVERIAKELREKAESSLDKIDTSLKGNGTTFNGRCKQIK
KENGAPNGDDCEFKTTYENSMEFLKETCNNNGKERFNIGQTWNCVKIKKIGKDLCIPPRR
EHMCLDDFKTLFRYNINDSTDLLKKIQEVAKSEGDDIIKNLLPQNSCNENVICDAMKYSF
ADIGDIIRGRDLLTNSSNQRIQRRLINAFTKIYSNLEPSKQTKYQKDITNLYELRSDWWD
ANRKHIWNAMTCNAPKDAKLNKRSEEPKGISPDGTHVSTLENCGYDKEPPDYDYIPQPFR
WMQEWSENVCKLLNKELDNFKNQCSDCKDNGNMCKNDIEKCERCKEQCETYKKLIDKWKL
EFDKYNDIYKEIFNNNKAKIRSEEYVNKFLNKLKDQCNESKSADKYLDEASHCTKYKFNN
DSDSNNNDNYAFKNLPKEYEKVCECEAPDPLDNCPKDNKHVSVCNNLSPTRSCESKTFNN
DDDSWTSVDVKDSTGNNKGVLVPPRRRQLCIRNMNRNLDNINNKADFRNKFLQYVYTEGK
FVGEKYKNDNKNALDAMRYSFYDYGDIVKGTDLIRTTPMDNLKTKLNVLLKENNGNEISK
DREKWWKDNKRQLWHAMLCGYKAAGGKIEEGDCTLPDDNTPQFLRWFREWSEHFCARQKE
LYQSVKKECESAKCNNEDGSIGPPECERACIEYTNYVTRKRQEYRSLKHQYNMNFKDMKD
KGKNAQHYFNDKCNGKCNCLSEYINNEKQWEEIYGSFNDSDVKNICVCQRIKPKRQRKKK
KPEDKTTPDEPKHKEDKIEPPPLSPIPPLPHPADEPFNRDILEKTIPLGIALALGSIAFF
FMKKKTKHPVDLFSVINIPKGDHDIPTKLSPNRYIPYTSGKYRGKRYIYLEGDSGTDSGY
TDHYSDITSSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSGNNTTASGNNTTASGNNT
TASGNNTTASDTQNDIQNDGIPSSKITDNEWNTLKDDFISNMLQNQPNTEPNMLGYNVDN
NTNPKTLHVSMDEKPFITSIHDRDLYSGEEYNYDMSTNSGIYPSSSNRDSLSGTKVPYSG
IDLINDSLNSGNQPIDIYDEVLKRKENELFGTNHVKQTSIHSVAKPARDDPIHNQLELFH
KWLDRHRDMCEQWENHHERLAKLKEKWENETHSGNTHPSDSNKTLNTDVSIQIHMDNPKP
INEFTNMDTNMDTPTMHSILDDLEKYNEPYYDVQDDIYYDVNDETPSVEDIPMDHNKVDV
PSKVQIEMDVNTKLVKEKYPIADVWDI
Download sequence
Identical sequences A0A0L7KHG9
PFHG_04057T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]