SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7KHJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7KHJ0
Domain Number 1 Region: 62-331,361-473
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.23e-79
Family Duffy binding domain 0.00034
Further Details:      
 
Domain Number 2 Region: 1680-2014,2053-2063
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.85e-77
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 3 Region: 847-903,938-970,1008-1109,1181-1359
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.02e-71
Family Duffy binding domain 0.00094
Further Details:      
 
Domain Number 4 Region: 2112-2492
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.11e-62
Family Duffy binding domain 0.00021
Further Details:      
 
Domain Number 5 Region: 2491-2818
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.27e-55
Family Duffy binding domain 0.0000491
Further Details:      
 
Domain Number 6 Region: 506-676,713-733
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-31
Family Duffy binding domain 0.0042
Further Details:      
 
Domain Number 7 Region: 1396-1604
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.41e-25
Family Duffy binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L7KHJ0
Sequence length 3263
Comment (tr|A0A0L7KHJ0|A0A0L7KHJ0_PLAFX) Uncharacterized protein {ECO:0000313|EMBL:KOB62354.1} KW=Complete proteome OX=137071 OS=Plasmodium falciparum (isolate HB3). GN=PFHG_04081 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVIQKTGGGGRIEDTTAKHIFDRIGKDVYDEIVEKGDAEKYYDDLHGSLKDARFEKDPNG
QQTRARPCQLDHQWHTNATNGRSYPCRTGTEKRFSEVSGGECDDSKIKGSNGGACAPYRR
LHLCVRNLENININKYINKDTLLADVCLAALHEGDSIRSDHDKYKLTNSSSQICTMLARS
FADIGDIIRGKDLYVGNRKEREKEELQKNLKTIFKKIYDNLVQNKKDAKGRYKDDGPDYF
QLREDWWYANRIMVWRAITCGAAGGTYFHATCGGAKTPTNKQCRCTTRVVPTYFDYVPQY
LRWFEEWAEDFCTKRKHKLQNAIKICRGKDKDGKKLYCDLNGYDCTRTAKGENKRFSDSN
CNKCSLPCDHFVHWIDNQKKEFLKQKNRYQNEISVKSRQKRNASKKDYKGYVKQFYEKFQ
DEYGDVETFLGKLSEEQICKNQPYNDERTIDINFKDDQREDIFSHTEYCQACPWCGMQCT
DNGNCTKKQDTSCHKEIPKKEYTETNTTTIPVLTPDKGKSNILDKYKNFCNSSDGKNDDQ
IKNDIWKCYYDNKNKDNESGDSNICVLQNNNIGKKEEKSMSYNSFFWKWVTEMLIDSIDW
RKELKRCTNNQLTKCKNKKCNNDCKCFERWVEQKKKKEWNKIVEHFKTQDFGKEGELIGK
IDYDYALKTLLDVEDILTNIKDGYKEVEGAEHIKKLLEEEERKNQVEVGADSKKKNTIDL
LFEDEEKEAEKCKENNPDKDCKQPQSPLRSDTSHDGAQSPAPNHEEHDDVHDDDIDQREL
KIEDDEDEVEDPPPEEEGEGPQQEAEEKKEEKAKDNTDESEPPKDKVNPCDIVKELFSDP
SKFKDVACEQKYSGNNSRLGWKCIPTSGEGTTTTDKSGGVCIPPRRRRLYVGHLQKWADK
VGDKGESQTLTGGEAAEGTEASGSSSHSSSTPSSESQPTSTTPPDSKEALLKAFVESAAV
ETFFLWDRYKKEWEAQKKAEKARENVTFGFPSSESEEKNPQNKLQESGTIPEEFLRQMFY
TLADYKDILFSGSKDAKNGYNYIFSGDKEMKEKEEKIKGAIDKVFSNSGSTPRTPRGPPQ
TSVKDPKAWWDQNGQHIWNGMVCALTYKESDEKNTGGTNKIEKDDDVYKKFFGENNNKNP
GTTSTQNGTYENNYHYSKVELKEENSETQAKPTQSSSSSGENTPTTLTDFISRPPYFRYL
EEWGETFCKERKKRLEEVRKGCREKHNGGDTFCSGDGHDCTENGNLKHKNMFDDLDCRDC
YEHCRKYKKWIDIKFEEFHKQEKKYKGEHGKLTKDKCGGGDNNCCEQIEKKKNAAEFLTA
LRHCKDGEGVEDKNNDNKINFEKPETTFGPLEYCKTCPYNIVKCNGAGRAKNGCTPVNGK
SWETVFNEMSGNGEKTTINVDMIDRRGPFIEKYVEKKSDKSFKDSYHFKSVRDQNWECKF
ENENKDVCKLKNFNDKIDLNQYTTFKVLIVYWLDDFLYGYYLLKKRKIIEECKKNGGNTC
DANSKNDCVCVKKWLNQKKEEWKQIQERFNDKYKDLSQQNKSLFRSFLETLIPQIAAAND
KKKTYNNLDELKKSLGCNCANHSHKSENSEKSDIIDCMLNKLENLKNIIKTCQNVPSGKP
DTPCQKSPTPVPDDEEDLLLEEEENQVEAPKICEGVIKAPPKQEEEVEKCEAAAPPPRRP
HTAPKKKEDACDIVEKIYRTSGGGTKGINNCFPKKGPFVWKCGDANLVKDEGVCMPPRRK
SLCIHSLERFSGTSQNELKEAFIKCAAAETCLLWHKYKKDKNGGTEAQKQLNEGTIPDDF
KRQMFYTFGDYRDICLDTDISAKTENGDITKAKSNIDRILPKEDGKTPDEDRKAWWDEIK
NDVWKGMLCGLSHASGNISNVETIKNNNTYSTIKFSGSNSPTLETFAQRPQFLRWMTEWG
EEFCKKRKEQVEKLRSECDGYECNEENMDDKKKTCEDACKAYQKWLKDWKPQYEQQSAKF
MTDKGKKEYAVDADVASSQNAHKYLSKKLKPICQNGTTTDKCDYNCMENASRQPQTSACS
QEQQQQGNTSSTQNHFPEAFDCPPKEIGDRCNCPKLPEPKYCVDKTAYDIRKENGKKSDN
SLKGNGNTYNGNCNNVTKDKYQKQNGGTCITNNECESKKNDRFKIGEKWDCVGDTTDAKN
KLCVPPRRKYMCLKKLEDIIGDNISDSNTLLEKIQDVAKSEGNDIIKKILPKYPCSEDVI
CKYMKYSFADLGDIVRGRDLLRNDPDQVRIQRRLINAFTKIYSNLEPSKRMKYQNDITNL
YELRSDWWDTNRKEIWKAMTCNAPYDAKIYITKEGGYISPLTWTKNHCGHNDDPPDYDYI
PQPLRWISEWSEQFCLYQKHLLESMKNCENCKKNSGECKQSVHGSCVDCKKKCEKYKKFV
ENWKAQFEIQDKAYKEIYKNATNNGGNGKGIDANTKKFVEKLKKICENDDFATADKYLEN
GSVCRRFKFGENHNGSDNYAFHNTPPRYKENCKCAEEFDPLDECPVDKDVCSYYKKYSCV
EKYFNKKSLKWTNDFVKKHLKKSESVRVPPRRRQLCLSSISTHGREIRDEKNFKQYILRD
ASSEAKMLSQYYNSDNEKALQAIKYSFADIGNIVKGDDMLEDGISEKIKNIFEHKINKRT
HSSSSSSEPNITPSTWWKENKEKIWNVMMCHYPVDEKTGTSCPKHDNIDEEHQFLRWFRE
WSEHFCSRRKELHEDVQTECSHVTCVNGIGNIDIKCIKACKNYSNFISIKQNEYESLKSE
YDNNYKQDKADGKEAHLYFKEKCKDDKCACFNEKLNVEDNWKNPYETLEDTLKGKCMCKP
PPPASNNTTDILEKTIPFGVALALGSIAFLFLKKKTKASVGNLFQILQIPKSDYGTPTPK
SKNRYIPYRSGQYKGKTYIYMEGDSSGDEKYAFMSDTTDITSSESEYEELDLNDIYVPGS
PKYKTLIEVVLEPSGNNTTASGKNTPSDNTPTPQPITDNEWNQLKHDFISNMLQNEPNDV
PNDYSSGDIPFNTQPNTLYFDKPEEKPFITSIHDRNLYTGEEYNYNIHMSSNSMDDIPIN
SHNNVYSGIDLINDSLNSGNQPIDIYDELLKRKENELFGTNHPKHTNTHNVAKPISDDPI
HNQIDLFHTWLDRHRNMCEKWENHHERLAKLKEQWENDTSTSGNTHPSDSNKTLNTNVSI
QIHMDDPKPINEFSNMDTILEDLEKYNEPYYDVQDDIYYDVNDHDTSTVDSNNMDVPSKV
QIEMDVNTKLVKEKYPIADVWDI
Download sequence
Identical sequences A0A0L7KHJ0
PFHG_04081T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]