SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7KI26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7KI26
Domain Number 1 Region: 22-212
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.01e-60
Family Glutathione peroxidase-like 0.00000379
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L7KI26
Sequence length 216
Comment (tr|A0A0L7KI26|A0A0L7KI26_PLAFX) Thioredoxin peroxidase {ECO:0000313|EMBL:KOB63003.1} KW=Complete proteome OX=137071 OS=Plasmodium falciparum (isolate HB3). GN=PFHG_04776 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MFLKKLCRSNFFGNSRRSFSLVTKKAYNFTAQGLNKNNEIINVDLSSFIGQKYCCLLFYP
LNYTFVCPTEIIEFNKHIKDFENKNVELLGISVDSVYSHLAWKNMPIEKGGIGNVEFTLV
SDINKDISKNYNVLYDNSFALRGLFIIDKNGCVRHQTVNDLPIGRNVQEVLRTIDSIIHV
DTSGEVCPINWKKGQKAFKPTTESLIDYMNNANKNV
Download sequence
Identical sequences A0A024V432 A0A024VPJ6 A0A024W3L0 A0A024WM29 A0A024X4N3 A0A0L1I5X7 A0A0L7KI26 A0A0L7M7S5 Q8I5Q6 Q9BKL4 W4IFH4 W4J3I4 W7EZ14 W7FRQ1 W7JRH9
gi|124805845|ref|XP_001350554.1| gi|23496678|gb|AAN36234.1| 5833.PFL0725w-1 PFL0725w PFDG_03866T0 XP_001350554.1.26446 PFHG_04776T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]