SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7KKE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7KKE2
Domain Number 1 Region: 40-142,195-330
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.71e-51
Family Duffy binding domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L7KKE2
Sequence length 333
Comment (tr|A0A0L7KKE2|A0A0L7KKE2_PLAFX) PfEMP1 {ECO:0000313|EMBL:KOB63585.1} KW=Complete proteome OX=137071 OS=Plasmodium falciparum (isolate HB3). GN=PFHG_05304 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
KIKLKEKQEERQRQAENAGLPLALAQEVSHEDPQTKLDGGDIPEEFKRQMFYTLADYKDI
LEGKNDIVIDKKTGDKDMVERESKIKDTIQTFFQNGDSQTPSVQQPSGENPRKTWWEQHG
KDIWKGMVCALTYDTDSGGKGKAPEHLEEVHKKFFGNTPDKPDNQNGTYTTKYQYNTVKL
DENSGAQPNQPPSAPSDTPTLTDFISRPPYFRYLEEWGQNFCKKRTEMLGKIKDNCTEDG
TKQKYSGDGEACDRTNTSNEGASADLEGPSCAISCRSYKKWIQKKKIEFEEQSNAYKQQK
QDAESNNAFSAILTKFNEAKDFLQKLGSCSKTD
Download sequence
Identical sequences A0A0L7KKE2
PFHG_05304T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]