SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7KKG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7KKG6
Domain Number 1 Region: 292-626,665-677
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-77
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 726-1048
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.35e-64
Family Duffy binding domain 0.00018
Further Details:      
 
Domain Number 3 Region: 1050-1222
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.49e-26
Family Duffy binding domain 0.00047
Further Details:      
 
Domain Number 4 Region: 11-216
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-25
Family Duffy binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7KKG6
Sequence length 1256
Comment (tr|A0A0L7KKG6|A0A0L7KKG6_PLAFX) Uncharacterized protein {ECO:0000313|EMBL:KOB63566.1} KW=Complete proteome OX=137071 OS=Plasmodium falciparum (isolate HB3). GN=PFHG_05358 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSGNGEKTTINVDMIDRRGPFIEKYVEKKSDKSFKDSYHFKSVRDQNWECKFENENKDVC
KLKNFNDKIDLNQYTTFKVLIVYWLDDFLYGYYLLKKRKIIEECKKNGGNTCDANSKNDC
VCVKKWLNQKKEEWKQIQERFNDKYKDLSQQNKSLFRSFLETLIPQIAAANDKKKTYNNL
DELKKSLGCNCANHSHKSENSEKSDIIDCMLNKLENLKNIIKTCQNVPSGKPDTPCQKSP
TPVPDDEEDLLLEEEENQVEAPKICEGVIKAPPKQEEEVEKCEAAAPPPRRPHTAPKKKE
DACDIVEKIYRTSGGGTKGINNCFPKKGPFVWKCGDANLVKDEGVCMPPRRKSLCIHSLE
RFSGTSQNELKEAFIKCAAAETCLLWHKYKKDKNGGTEAQKQLNEGTIPDDFKRQMFYTF
GDYRDICLDTDISAKTENGDITKAKSNIDRILPKEDGKTPDEDRKAWWDEIKNDVWKGML
CGLSHASGNISNVETIKNNNTYSTIKFSGSNSPTLETFAQRPQFLRWMTEWGEEFCKKRK
EQVEKLRSECDGYECNEENMDDKKKTCEDACKAYQKWLKDWKPQYEQQSAKFMTDKGKKE
YAVDADVASSQNAHKYLSKKLKPICQNGTTTDKCDYNCMENASRQPQTSACSQEQQQQGN
TSSTQNHFPEAFDCPPKEIGDRCNCPKLPEPKYCVDKTAYDIRKENGKKSDNSLKGNGNT
YNGNCNNVTKDKYQKQNGGTCKIKDDFLSSIGITNNECESKKNDRFKIGEKWDCVGDTTD
AKNKLCVPPRRKYMCLKKLEDIIGDNISDSNTLLEKIQDVAKSEGNDIIKKILPKYPCSE
DVICKYMKYSFADLGDIVRGRDLLRNDPDQVRIQRRLINAFTKIYSNLEPSKRMKYQNDI
TNLYELRSDWWDTNRKEIWKAMTCNAPYDAKIYITKEGGYISPLTWTKNHCGHNDDPPDY
DYIPQPLRWISEWSEQFCLYQKHLLESMKNCENCKKNSGECKQSVHGSCVDCKKKCEKYK
KFVENWKAQFEIQDKAYKEIYKNATNNGGNEPNITPSTWWKENKEKIWNVMMCHYPVDEK
TGTSCPKHDNIDEEHQFLRWFREWSEHFCSRRKELHEDVQTECSHVTCVNGIGNIDIKCI
KACKNYSNFISIKQNEYESLKSEYDNNYKQDKADGKEAHLYFKEKCKDDKCACFNEKLNV
EDNWKNPYETLEDTLKGKCMCKPPPPASNNTTDILEKTIPFGVALALGSIAFLFLK
Download sequence
Identical sequences A0A0L7KKG6
PFHG_05358T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]