SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7KKK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7KKK2
Domain Number 1 Region: 74-431
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.59e-66
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 2 Region: 2051-2329,2360-2375
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.54e-58
Family Duffy binding domain 0.0000458
Further Details:      
 
Domain Number 3 Region: 2382-2626
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.46e-54
Family Duffy binding domain 0.0000986
Further Details:      
 
Domain Number 4 Region: 1258-1330,1364-1604
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.06e-53
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 5 Region: 560-857,904-920,960-979
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-50
Family Duffy binding domain 0.00034
Further Details:      
 
Domain Number 6 Region: 1595-1789,1824-1946
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.4e-47
Family Duffy binding domain 0.00012
Further Details:      
 
Domain Number 7 Region: 1019-1168
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.000000145
Family Duffy binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L7KKK2
Sequence length 2628
Comment (tr|A0A0L7KKK2|A0A0L7KKK2_PLAFX) Uncharacterized protein {ECO:0000313|EMBL:KOB63857.1} KW=Complete proteome OX=137071 OS=Plasmodium falciparum (isolate HB3). GN=PFHG_05046 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MDSKTTIAEKIEEYLKEKSNDSKIDQSLKADPSEIDYYNFGGDGYYLKNNICKITVNHSD
SGTNDPCEKKLLPYGDNDQWKCDENLFKASGNHKNICVPPRRQHMCINNLEKLKFDKIRD
KHAFLADVLLTARNEGERIVQNHPDTNSSNVCVALERSFADLADIIRGRDENKCETKSTN
NVEELIKNFFGKNYRSNEEYKRKYRNDDPKYTKLREAWWNANRQKVWEVITCGARSNDLL
IKRRWRTSKESNGDNKLELCRKCGHYEEKVPTKLDYVPQFLRWLTEWIEDLYREEQNLID
DMERHREECTRKNVESNEGASYCNMCKEKHTKYCECVKKWKSEWENQKNKYTELYEQENE
TSQKNTSRYDDYVKDFFEKLKGNEYSSANSYVKNNPYSAEYVTKLSFILNSSDANTSSET
PSKYYDEVCNCNESEISSVGQAQTSGPSSNKTCITHSSIKTNKKKVCKDVKLGINNNDKV
LRVCVIEDTSLSGVDNCCCQDLLGILQENCSDKNQSGSSSNGSCNNKNQDECQKKLEKVF
ASLTNGYKCDKCKSGTSRSKKKWIWRKSSGNEEGLQKEYANTIGLPPRTQSLYLGNLRKL
ENVCKGVTDINFDTKEKFLAGCLIAAFHEGKNLKTTYPQNKKKLCKDLKYSFADYGDLIK
GTSIWDNEYTKDLELNLQKAFGKLFRKYIKKNISTEQHTLYSSLDELRESWWNTNKKYIW
LAMKHGAGMNSTTCCGDGSVTGSGSSCDDIPTIDLIPQYLRFLQEWVEHFCKQRQEKVNA
VIENCNSCKECGDTCNGECKTECEKKCKIECEKYKTFIEECVTAVGGTSGSPWSKRWDQI
YKRYSKYIEDAKRNRKAGTKNCGITTGTISGESSGANSGVTTTENKCVQSDIDSFFKHLI
DIGLTTPSSYLSIVLDDNICGADNAPWTTYTTYTTYTTTKNCDIKKKTPKSQPINTSVVV
NVPSPLGNTPHGYKYACQCKIPTTEESCDDRKEYMNQWIIDTSKKQKGSGSTNNDYELYT
YNGVKETKLPKKSSSSKLDDKDVTFFNLFEQWNKEIQYQIEQYMTNTKISCIDEKEVLDS
VSDEAAQPKFSDNERDRNSITHEDKNCKKNCECYELWIKKITEQWETQKKNYNKFQSKQI
YDGNNASHKKEIVKLSNFLFFSCWEEYIQKYFNGDWSKIKNIGSDTFEFLIKKCGNNSGD
GETIFSEKLNNAQQQCKEIQNTDTKMKSSETSSKCNEPIYIRGCQPKRYDGFISPGKGGE
KQWICKDTIIHGDTNGACIPPRTQNLCVGNLWDKRYGGRSNIKNDTKESLKNKLKNAIQK
ETELLYEYHDKGTAIISRNPMKEGGEDGKGKQKEGGEEANNNSNGLPKGFCHAVQRSFID
YKNMILGTSVNIYEYIGKLQEDIKKIIEKGTPQQKDKIGGVGSGADKVNDWWKGIEGEMW
GAVKCGIKTINKKQKKNGTYTGNECGVSPPTGNDEDQSVSWFKEWGEQFCIERLRYEQNI
REACTINGKNEKKCINSKSGQEDKVEGACKRKCEKYKKYISEKKQEWDKQKTKYENKYVG
KFASDLLKENYPECISANFDFIFNDNIEYKTYYPYGDYSSICSCEQVKYYKYNNAEKKNN
KSLCHEKGNDRTWSKKYIKKLENGRSLEGVYVPPRRQQLCLYELFPIIIKNKKDMENVKK
ELLETLQIVAEREAYYLWKQYHAHNDTTYLAHKKACCAIRGSFYDLEDIIKGNDLVHDEY
TKYIDSKLNKIFGSSNKNDIETKRARTDWWENETIDVPKIDVANGTDHKTIRQLVWDAMQ
SGVRKAIDEENEKKKQNENFPPCMGVEHIGIAKPQFIRWLEEWTNEFCEEYTKYFEDMKS
KCDLRKGADDCGDNTNIECKRACANYTNWLNPKRIEWNGMSNYYNKIYRKSNKESEDGKD
YSMIMEPTVIDYLNKRCHGEINGNYICCSCKNIGAYNTTSGTVNKKLQKKETECEDNKGP
LDLMNEVLNKMDEKYSAHKMKCTEFYLEHVEEQLKEIDNAIKDYKLYPLDRCFDDKSKMK
VCDLIADAIGCKDKTKLDELDEWNDVDMRGTYNKHKGVLIPPRRRQLCFSRIVRGPANLR
SLNEFKEEILKGAQSEGKFLGNYYNEDKGKEKKEDRKEKALEAMKNSFYDYEDIIKGTDM
LTNIEFKDIKMKLDKLLTKETNNTKKAEDWWKTNKKSIWNAMLCGYKKSGNKIIDRSWCT
IPTTETPPQFLRWIKEWGKNVCIQKEKYKQNVKSECSNVSNIDLDPQASESNNCTSEIRK
YQELIRKRSIQWEAISERYRKYKGMDVLKNVKEPDANEYLKEHCSKCPCGYNDMQEIAND
TENKQDIFKQIKEQVDIPAELEDVIYRLKHHKYNSNDYICNKYKNINVNMKKNNDNIWTD
LLVKNSSDINKGVLIPPRRKNLFLNIEKSDICKYKKNPKLFNDFIYSSAISEVERLKKVY
GEARAKVANAMKYSFADIGNIIKGDDMMKSPTSKYIEQIFKGTEYSGIDSETWWDMNKYH
IWESMLCGYKQAGGDTKTNENCRFPDTDGVPQFLRWFQEWTETFCVTRQELYNDVKSACE
SGSCDTKKGKIDRADCESSCNKYKNFILIKETEYNDQKNKFVKNFKCV
Download sequence
Identical sequences A0A0L7KKK2
PFHG_05046T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]