SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7KLD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7KLD0
Domain Number 1 Region: 233-250,296-366,401-494,548-722
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.22e-78
Family Duffy binding domain 0.00072
Further Details:      
 
Domain Number 2 Region: 714-933
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.67e-37
Family Duffy binding domain 0.0074
Further Details:      
 
Domain Number 3 Region: 6-131,180-200
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.62e-25
Family Duffy binding domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7KLD0
Sequence length 1558
Comment (tr|A0A0L7KLD0|A0A0L7KLD0_PLAFX) Uncharacterized protein {ECO:0000313|EMBL:KOB63876.1} KW=Complete proteome OX=137071 OS=Plasmodium falciparum (isolate HB3). GN=PFHG_05079 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKNGNIDKCNGIPIEDYIPQRLRWMTEWAEWFCKMQSQQYDKLEEECGICMNGTCKDVLG
KGCVDCKKQCQEYEKNIKEWADQWTIMDMKYRTLYLQAQITARNPGDTSFDNPNDQYVIK
FLQKLQEATGDTTRATTSTTITPYSTAAGYIHQEIGYGGCQVQTQFCEKENGDTSSTATN
NGKYAFKHPPTDYKDKCECKENEAQPKKVETPKHNVEVCSIVEQALKTSLTDACTLKYGS
KSHVGWKCVTPSGEKSGGSEPTGTESERLTRQRREAGVPTTTSSGPTSGKSGDTTGGSIC
IPPRRRRLYIGGLTKLTSDETQSQSLETSGGQKTPSGKESSQSDKLRTAFIQSAAIETFF
LWHKYKMDKAREDIEKRQGENGLVVITSSKPDDLDNELKSGDIPEEFKRQMFYTLADYKD
ILYSGSNDEKNGYNDIFSGDKEIKEREEKIKEKITNFFQNGDSQPPSDEKRKDWWDKNAS
HIWKGMICALTYKDSGTKETPPKQIDEVQKAFFGDNNNRNPPLPVKPGTYQSTYDYTNVS
FSGGFNSDKNAATITTKLENFVKRPTYFRWLEEWGEEFCRKQKHKLDIIKKDCYKDGKKD
CSGDGLRCDEEVPENKKIYEGFHCPSCANSCGLYKRWIGRKKDEFTQQSNAYKEQQGKCQ
TESDNGFCGTLQKFTTAGDFLQKLKKGPCKTNNDTEKVNEEGKKFFDKNGDTFKHAKDCA
PCSQFTVDCKNCNGGGGTKGKCNGRNTGTTTITASDIENAGNSAEDIGMVVSDDNTNGNK
FEHLQDCTDANIFKGFRKDVWKCGEYCGVDICTLEKKDTNGEVKEHIIVKELLKRWLEYF
LEDYNRIRKKIKPCIENGKGSTCIRSCVDEWIKKKKEEWDKINDTYIQEYTRNNNVTSND
LNSFLEPLISQIPVVNDKGEHSSLQKLEKSLGCKCAKSSEEKVVKQDKNSDIVDCMLDKL
QIKIEKCKKIYHENGDNKCTETSQQTLDLNVETLDDDIETEEAKKMMPTFCNIDEPKEPV
VEEKCEASTGKPEGGSDGEKEEEKPKGVEEEEKVPPPPATDTRPAPPSPPLPLPSDEPFN
RDILEKTIPFGIAFALGSIAFLFLKKKTKSTIDLLRVINIPKSDYDIPTKLSPNRYIPYT
SGKYRGKRYIYLEGDSGTDSGYTDHYSDITSSSESEYEELDINDIYAPRAPKYKTLIEVV
LEPSGNNTTASGNNTTASDTQNDIQNDGIPSSKITDNEWNTLKDEFISQYLQSEQPNDVP
NDYSSGDIPMNTQPNTLYFNKPEEKPFIMSIHDRDLYTGEEYNYNVNMSTNSMDDPKYVS
NNVYSGIDLINDSLSGEPINIYDEVLKRKENELFGTNNPKRTSTYSVAKNTNSDPLHNQL
ELFHTWLDRHRDMCEKWENQHERLAKLKEEWENETHSGNKHSDIPSGKLSDIPSDNNIHS
DIHPSDIPSGKQSDIPSDNNIPSSNQILNTDVSIQIHMDNPKPINQFTNMDTILEDLEKY
NEPYYDVQDDIYYDVNDDNDISTVNPNNMEKPSKVKIELDVNKKTIKEKYPIADVWDI
Download sequence
Identical sequences A0A0L7KLD0
PFHG_05079T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]