SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7KLT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7KLT0
Domain Number 1 Region: 1-174
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.32e-23
Family Duffy binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  A0A0L7KLT0
Domain Number - Region: 204-254
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0085
Family Duffy binding domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L7KLT0
Sequence length 260
Comment (tr|A0A0L7KLT0|A0A0L7KLT0_PLAFX) Uncharacterized protein {ECO:0000313|EMBL:KOB64262.1} KW=Complete proteome OX=137071 OS=Plasmodium falciparum (isolate HB3). GN=PFHG_05573 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
YLRWFDESTEEFCRLRRKKIEILEKICRGKNDSGQPKYCSRNGCDCEQTINKIGRIRLGN
GCTNCLFACNRYIDWINNKKKEFLKQKKKYDKVINRTYSQETGLSNNIINKYDNKFYKEL
RNQYGSLQNFLQLLNKEKECLEKPHVEGNIKHINFSNANDTFYRSKYCESCPECGVVFKN
GQFIEREEDGRCIKEERDRTKEPKITFIDFLLNEEEGNDIVKKLKPFCGHTVSKKYEEIE
KWKCSHYEDTDNDCEMQKKW
Download sequence
Identical sequences A0A0L7KLT0
PFHG_05573T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]