SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7KMX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7KMX8
Domain Number 1 Region: 2-67,107-127
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000000017
Family Duffy binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7KMX8
Sequence length 186
Comment (tr|A0A0L7KMX8|A0A0L7KMX8_PLAFX) Uncharacterized protein {ECO:0000313|EMBL:KOB64309.1} KW=Complete proteome OX=137071 OS=Plasmodium falciparum (isolate HB3). GN=PFHG_05598 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MDDKKKTCEDACKAYQKWLKDWKPQYEQQSAKFMTDKGKKEYAVDADVASSQNAHKYLSK
KLKPICQNGTTTDKCDYNCMENASRQPQTSACSQEQQQQGNTSSTQNHFPEAFDCPPKEI
GDRCNCPKLPEPKYCVDKTAYDIRKENGKKSDNSLKGNGNTYNGITNNECESKKNDRFKI
GEKWDC
Download sequence
Identical sequences A0A0L7KMX8
PFHG_05598T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]