SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7LKG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7LKG3
Domain Number 1 Region: 22-120
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 1.44e-31
Family Chemosensory protein Csp2 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7LKG3
Sequence length 122
Comment (tr|A0A0L7LKG3|A0A0L7LKG3_9NEOP) Chemosensory protein 15 {ECO:0000313|EMBL:KOB75937.1} KW=Complete proteome; Reference proteome OX=104452 OS=Operophtera brumata (winter moth). GN=OBRU01_07137 OC=Geometroidea; Geometridae; Larentiinae; Operophtera.
Sequence
MFVVLIFSYLFLSIVLADEKSYDRRYDYFEVDYFVNNPRLLKKYLDCFLDQGPCTPIGRV
FKKVLPEVIRTACEKCTPLQKKFTKKAFDAFKMSLPESHAELKMKYDPRNMYYDAFETAI
AI
Download sequence
Identical sequences A0A0L7LKG3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]