SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7LWA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7LWA3
Domain Number 1 Region: 68-490
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.76e-79
Family Duffy binding domain 0.0005
Further Details:      
 
Domain Number 2 Region: 829-941,980-1055,1091-1270
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-75
Family Duffy binding domain 0.00067
Further Details:      
 
Domain Number 3 Region: 1989-2286
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.92e-57
Family Duffy binding domain 0.0000317
Further Details:      
 
Domain Number 4 Region: 1639-1961
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.32e-55
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 5 Region: 1321-1527
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.02e-35
Family Duffy binding domain 0.0028
Further Details:      
 
Domain Number 6 Region: 520-665,710-729
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-32
Family Duffy binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7LWA3
Sequence length 2802
Comment (tr|A0A0L7LWA3|A0A0L7LWA3_PLAF4) Uncharacterized protein {ECO:0000313|EMBL:KOB84946.1} KW=Complete proteome; Reference proteome OX=57267 OS=Plasmodium falciparum (isolate Dd2). GN=PFDG_00299 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MGRSGSGGGTQEQEDRYKYTIVSDAKDLLDRIGEDIYKIANEAALKRSYNDLQGFLSLAT
YPKDRKSTGSTPSKSCDLHYNFHTNVTSNVIEPCKHKSEKRFSDTQGAECDYRKIKCKKD
SDNECGACAPYRRLHVCDKNLEQLTPEKITTHNLLVDVCQAAKFEGESIRGYYALYDTQY
PSSGSTMCTMLARSFADIGDIVRGRDLFLGYNETDRKEKKQLQQNLKNIFGIIYGKLKNG
KKWAEAKKHYGSDENFFKLREDWWNANRETVWDAITCEAQGFNYFRHTCGTGEKRTQTGD
NCQCIDQTVPTYFDYVPQYLRWFEEWAEDFCRLRKHKLQNAIKNCRGDSGKERYCDLNGY
NCEETARGRNKFAPDSNCHKCSVACDRFVKWIDNQKKEFEKQEKKYTKEIKKDHGTTLQV
GKTTINNLYVDDFYKILKKYYPTVDKFLEKLSKEKICEKQPEVEGKGKSIDFNDEPDDIF
SRTKYCRACPLCGVNGPKGKWKDIDDGVCANLNKKKNYKEDNITDIPVLTPEKGKTGILK
KYETFCATGVGQIKKWECYYDEDKPSGQNNNCILGKWESFTGEEDVMSYNAFFWKWVSEM
LDDSIKWRAELDKCLKNDKKTCGKKKCNRDCKCYKKWVKKKETEWEEIEKHFRKQKDMEN
EGLNFEMALKILLNDVFLQDMIDANGDPQQIAKIKELKEKKNDEREDYSKAKTIIDLLID
EEEQDADECVTNNPDNECKQAPTDGESPLRSDTPTPSSPAPSSPPKKEDSDSEEEEEEEE
GEGEDHTAEDTKVNGEVAQPEPTTDKTTPLDVCNIVETLFTTPKSLDEACKQKYDGKYYG
WRCVPTTSGGEKTTGKSDTGGSICIPPRRRRLYVGKLTQWASQVPQEGGGNDTAGGSESP
QSSSNTTVNAASTETTLSSLLRQAFIQSAAVETFFAWYEYKEDKIREDKEKKEREREFAL
FLNQEEPLTDKHLQKELEKGEIPEEFLRQMFYTFGDYKDILFGKDIGIDMGTVKTNIGRV
FNNGGNKSDEERKNWWKNHGPSIWEGMLCALTYDTKTKIKDESVSTELTKENNKNTYDNV
TISSIPINSGNKSDTTLLQFTERPTFFRWLEEWGEEFCRKRTDRLAQIKHECRGKYNNKH
CDADGHDCKLTSPEKNKNLSDLDCPGCAKECMKYKTWIGKKFEEFKKQENTYKVEHRKLN
GNSNGDNKEFCDQIKEKKNAADFLKALKHCKDAQNNSEEKGNQEDKLNKINFDKPENTFN
PSTYCKTCPFNGVNCNGSGRGKSGTNGCTTNTEPANKDNAEGVATTIPILINDGSTNGAT
NGTTKDIDEELKNCSEKYSLFKGLSKQVWTCQYLNGVDQCKLTNSVDNIDDSDKIIPFNV
FFQRWLRDFVRDYNILKGKIKACIKNENEKEKEKSHKCIKECNDKCKCVEEWLDKKEVEW
KKIKEHYDQQKTHYGYSIPHWVKSYFEQEPFDTDYKKAQEVVENPNEREELWGNTGRNYN
NRQHTQTNDDFITNLISKLQDKIKTCQNKHNPSGETKAPCEETPLDDDTPDEPLDDYYIQ
QPKICPPPMTCVEKIAKELRVEAEENAKTYDQKLKGKGENFNGQCNMVKKNDTPSNGKNN
CDFDKTYKNSLDNITKTCEGGYNVSDSTVLLKKVQEIARNEGDDIIRKLLEQNSCDEHRI
CDAMKYSFADLGDIIRGRDLWNTNRKEKGVQQRLRNIFKNIYNDLRNDQIKSKYSDPPFY
YKLRSDWWDANRKHIWNAMTCNAPDDAKFLKKNPNDTSGSSSAKGIMTRHPKCGYDKEPP
DYDYIPQPFRWMQEWSEYYCKLLNEEIKKFATECKECRNNGSSCKDDTTGKKCENCKKQC
EKYKNLVDKWKSEFDKYKETYKEIYNNNNNNNNKAKISSEEYFKKFLEKLKAECTGKDTA
DKYLDEASHCTKYKFIENDNNSNDNYAFKHTPKDFEQACKCEAPDPLDECPKDNKHVSVC
KNLSPTRSCESKTFNNDDDSWTSVDVKDSKGKNHGVLVPPRRRQLCIRNMNRNLDTINNI
SDFKKIFLQYVYTEGYYLWHKYKNDNKNALDAMHYSFYDYGDIVKGTDLISTILMDKLKT
KLNVLLKEDGGNERSQNRGKWWANNKNRVWNAMLCGYKKAGGTIGPNDCNIPSEENTHQF
LRWFREWSEHFCARQQKLFNEVKRECESAKCNNENGKTDNVNCEGACVQYKNYITRKIEE
YRLLNYQYNVYFKKQHAEGKNAPEYFINKCNSKCNCLSQHIDKEKKWKNIYDSLGDNNLK
NKCDCIKIKPQIIPNREKPKEETKPPLPDLDPLPADEPFDSTILQTTIPFGVALALGSIA
FLFLKKKTKSTIDLLRVINIPKSDYDIPTKLSPNRYIPYTSGKYRGKRYIYLEGDSGTDS
GYTDHYSDITSSSESEYEEMDINDIYVPGSPKYKTLIEVVLEPSGKLSGNTIPTSGKNTP
TSNIPSDNTPTPQPITDNEWNTLKQDFISNMLQSEQPKDVPNDYKSGDIPFNTQPNTLYF
NKPEEKPFIMSIHDRNLYTGEEISYNVNMSTNSMDDPKYVSNNVYSGIDLINDSLSGGKP
IDIYDELLKRKENELFGTNNPKRTSTYSVAKLTNSDPIHNQLELFHKWLDRHRDMCEKWN
NKEEVLDKLKEEWNKDNNNNSGTPSDNTTPTTGITPPTSDNTPPTSDNTPPTSDIPSGNH
VLNTDVSIQIHMDDPKPINEFTNMDTYPNNSSMDTILEDLEKYNEPYYYDMYDDDIYYDV
NDHDTSTVDSNNMDVPSKVQIEMDINTKLVKEKYPIADVWDI
Download sequence
Identical sequences A0A0L7LWA3
PFDG_00299T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]