SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7LWG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7LWG1
Domain Number 1 Region: 356-444,481-569,622-799
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-81
Family Duffy binding domain 0.00061
Further Details:      
 
Domain Number 2 Region: 781-1010
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-41
Family Duffy binding domain 0.0048
Further Details:      
 
Domain Number 3 Region: 2-182,234-254
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.98e-31
Family Duffy binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L7LWG1
Sequence length 1662
Comment (tr|A0A0L7LWG1|A0A0L7LWG1_PLAF4) PfEMP1 {ECO:0000313|EMBL:KOB84853.1} KW=Complete proteome; Reference proteome OX=57267 OS=Plasmodium falciparum (isolate Dd2). GN=PFDG_00174 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVKKYKKFCNGNGGNGATGTVNGGENGKKGASGKNGDNITETWTCYYKKKNENNDGKKEI
NFCVLQDGNQHTKDRKDKSYNAFFWDWVHDMLIHSIKWRNELGNCINKDNDNTCKKKNKC
NNDCKCFLKWVNEKKKEWTEIKIHFGKQDFGTQGENGAIDMLGELMRCPSYVLKTVLEKD
LLLEIIEGTYGKSKETEAINKILDDEEAAVLGILGGVFGDFDTGAMCGTGSANGKNSIID
KLLNREENDATKCQKDCQEPQKPQEQATSDVARSATGTSPQTPDQQAPPSDEEEEEEEEE
EDDAEDAGGGGEVEEEEKQEVVEVKEGTEEQQPPTTTVVDVCATVAEALKGKLDDACTLK
YSGNNSRLGWKCIPSGKPGDTGSSGAICVPPRRRRLYVTPLTKWAETVAQPQESGGNTES
SDKLREAFIQSAAVETFFLWHRYKKEWEHRNNKTQDGGSQLLQLPGAESDDNDPQTLLQS
GKIPPDFLRQMFYTLGDYRDIFFGKDVVDETKGISEKIKDILEKANGGTPPSDKNPNEKR
EQFWKQHGKDIWQGMVCALTYTDSGDKDKPPEVDKKVKEAFFGTPNGKPGTTSTQNGTFK
DKYDYEKVTLENSETEAISNDTLNNPKLTQFVLRPPYFRYLEEWGETFCRERKKRLEKIE
EECMDGKTKKCSGDGENCKDIRTQDYSTVRDFNCPGCGKYCRFYKKWISAKKNEFEKQKS
AYEQQKEKCQTESESAKNNKDYKQFCGTPETTSPTAGDFLNRLKSGPCKTDNENGEGDID
FNNQSKTFKHTNLCDPCSLIGAKCKSSDCSGGGTKVECKDNKITAEKIGNGVDSTVLDMR
VSDDSKSGFNDDGLQACEHAGIFTGIRKEEWKCGKVCGVDICYLKGDNQKNHDKKNILIR
ALLKRWVENFLEDYNKINGKISHCTNTVEGSKCISGCEEKCKCVEEWIKLKQQEWPKIRD
RYVKQYKGAESDMKSSVKNFLEDLQSQIDFKSAIKPCGDLRAFERSIHCNGAVSSENDIQ
KDVVECLLDKLEDKAKECKEDQKPNGENPETKSQNTHHVGDEDDEPMEGENPENKVGHPQ
ICKDVLPEPKPEEKDTCDDANPPSTEPKQSAEEENADKKSGSEASDTLPGPAPPGPPATT
EPEEKAAPAPSKEKPNPEQTPILKPEEEAPPPEASEPNKEETPPVPPTLSDQPTNSIGDI
LSSTIPFGIAIALTSIVFFLKKKTKSTIDLLRVINIPKSDYDIPTKLSPNRYIPYTSGKY
RGKRYIYLEGDSGTDSGYTDHYSDITSSSESEYEELDINDIYVPHAPKYKTLIEVVLEPS
GKLSGNTIPTSDKNTPSDTQNDIQNDGIPSSKITDNEWNTLKDEFISNMLQNEPNTEPNI
LRDNVDNNTHPTTSRHNIDQKPFITSIHDRDLYSGEEYNYDMSTNSGNNDLYNGKNNLYS
GIDPTSDNRGLTSGKHDSYSGIDLINDSLSGDYDIYDEMLKRKENELFGTNHVKQTSIHS
VAKPARDDPIHNQLELFHKWLDRHRDMCEKWENHHERLAKLKEKWENDTSTSGNTHPSES
NKTLNTDVSIQIDMDHGKPKKEFTNMDTNMDTPTMHSILDDLEKYNEPYYDVQDDIYYDV
NDHDTSTVDTNAMDVPSKVQIEMDINTKLVKEKYPIADVWDI
Download sequence
Identical sequences A0A0L7LWG1
PFDG_00174T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]