SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7M056 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0L7M056
Domain Number - Region: 3-57
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00597
Family Thioltransferase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7M056
Sequence length 174
Comment (tr|A0A0L7M056|A0A0L7M056_PLAF4) Uncharacterized protein {ECO:0000313|EMBL:KOB85885.1} KW=Complete proteome; Reference proteome OX=57267 OS=Plasmodium falciparum (isolate Dd2). GN=PFDG_01409 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
IKLKIKKYNIEKNDYAPNMIVSRGTPTFLLYHNGKGNKLAEYKPNDIINKIDEIIESPKN
MKEQMLEKVELIHERMHLFGYLTMWMTESKMIENMLIKRHIKDLSPKKSDDENIYNDILT
SLIEEDIHRNDLIEESLDYSKEKIKEAEKGCFVAAMMMANELIDEEKKKFRDIK
Download sequence
Identical sequences A0A0L7M056
PFDG_01409T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]