SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7M7M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7M7M8
Domain Number 1 Region: 430-740
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-69
Family Duffy binding domain 0.00000000000591
Further Details:      
 
Domain Number 2 Region: 153-425
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.81e-56
Family Duffy binding domain 0.0000000000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7M7M8
Sequence length 1321
Comment (tr|A0A0L7M7M8|A0A0L7M7M8_PLAF4) Uncharacterized protein {ECO:0000313|EMBL:KOB88874.1} KW=Complete proteome; Reference proteome OX=57267 OS=Plasmodium falciparum (isolate Dd2). GN=PFDG_03801 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKCNISIYFFASFFVLYFAKARNEYDIKENEKFLDVYKEKFNELDKKKYGNVQKTDKKIF
TFIENKLDILNNSKFNKRWKSYGTPDNIDKNMSLINKHNNEEMFNNNYQSFLSTSSLIKQ
NKYVPINAVRVSRILSFLDSRINNGRNTSSNNEVLSNCREKRKGMKWDCKKKNDRSNYVC
IPDRRIQLCIVNLSIIKTYTKETMKDHFIEASKKESQLLLKKNDNKYNSKFCNDLKNSFL
DYGHLAMGNDMDFGGYSTKAENKIQEVFKGAHGKISEHEIKNFRKKWWNEFREKLWEAML
SEHKNNINNCKNIPQEELQITQWIKEWHGEFLLERYNRSKLPKSKCKNNTLYEACEKECI
DPCMKYRDWIIRSKFEWHTLSKEYETQNVSKENAENYLIKISKNKNDAKVSLLLNNCDAE
YSKYCDCKHTTTLVKSVLNGNDNTIKEKREHIDLDDFSKFGCDKNSVDTNTKVWECKKPY
ILSTKDVCVPPRRQELCLGNIDRIYDKNLLMIKEHILAIAIYESRILKRKYKNKDDKEVC
KIINKTFADIRDIIGGTDYWNDLSNRKLVGKINTNSNYVHRNKKNDKLFRDEWWKVIKKD
VWNVISWVFKDKTVCKEDDIENIPQFFRWFSEWGDDYCQDKTKMIETLKVECKEKPCEDD
NCKSKCNSYKEWISKKKEEYNKQAKQYQEYQKGNNYKMYSEFKSIKPEVYLKKYSEKCSN
LNFEDEFKEELHSDYKNKCTMCPEVKDVPISIIRNNEQTSQEAVPEENTEIAHRTETPSI
SEGPKGNEQKERDDDSLSKISVSPENSRPETDAKDTSNLLKLKGDVDISMPKAVIGSSPN
DNINVTEQGDNISGVNSKPLSDDVRNSLNHEEVKEHTSNSDNVQQSGGIVNMNVEKELKD
TLENPSSSLDEGKAHEELSEPNLSSDQDMSNTPGPLDNTSEETTERISNNEYKVNEREGE
RTLTKEYEDIVLKSHMNRESDDGELYDENSDLSTVNDESEDAEAKMKGNDTSEMSHNSSQ
HIESDQQKNDMKTVGDLGTTHVQNEISVPVTGEIDEKLRESKESKIHKAEEERLSHTDIH
KINPEDRNSNTLHLKDIRNEENERHLTNQNINISQERDLQKHGFHTMNNLHGDGVSERSQ
INHSHHGNRQDRGGNSGNVLNMRSNNNNFNNIPSRYNLYDKKLDLDLYENRNDSTTKELI
KKLAEINKCENEISVKYCDHMIHEEIPLKTCTKEKTRNLCCAVSDYCMSYFTYDSEEYYN
CTKREFDDPSYTCFRKEAFSSMPYYAGAGVLFIILVILGASQAKYQRLEKINKNKIEKNV
N
Download sequence
Identical sequences A0A0L7M7M8
PFDG_03801T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]