SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7M8M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7M8M3
Domain Number 1 Region: 83-400,431-484
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.15e-85
Family Duffy binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 498-681,715-735
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-38
Family Duffy binding domain 0.008
Further Details:      
 
Weak hits

Sequence:  A0A0L7M8M3
Domain Number - Region: 716-813
Classification Level Classification E-value
Superfamily ARM repeat 0.0449
Family Exportin HEAT-like repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7M8M3
Sequence length 887
Comment (tr|A0A0L7M8M3|A0A0L7M8M3_PLAF4) Uncharacterized protein {ECO:0000313|EMBL:KOB89171.1} KW=Complete proteome; Reference proteome OX=57267 OS=Plasmodium falciparum (isolate Dd2). GN=PFDG_04719 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
IYVSDAKDLLDRIGEKVYEEKVKNGDAKKYIEALKGNLNTANGRSSETASSIETCTLVKE
YYERVNGDGKRHPCRKDAKNEDVNRFSDTLGGQCTYNRIKDSQQGDNKVGACAPYRRLHL
CDYNLESIDTTSTTHKLLLEVCMAAKYEGNSINTHYTQHQRTNEDSASQLCTVLARSFAD
IGDIVRGKDLYLGYDNKEKEQRKKLEQKLKDIFKKIHKDVMKTNGAQERYIDDAKGGDFF
QLREDWWTANRETVWKALICHAPKEANYFIKTACNVGKGTNGQCHCIGGDVPTYFDYVPQ
YLRWFEEWAEDFCRKKKKKLENLQKQCRDYEQNLYCSGNGYDCTKTIYKKGKLVIGEHCT
NCSVWCRMYETWIDNQKKEFLKQKRKYETEISGGGSGKSPKRTKRAARSSSSSDDNGYES
KFYKKLKEVGYQDVDKFLKILNKEGICQKQPQVGNEKADNVDFTNEKYVKTFSRTEICEP
CPWCGLEKGGPPWKVKGDKTCGSAKTKTYDPKNITDIPVLYPDKSQQNILKKYKNFCEKG
APGGGQIKKWQCYYDEHKPSSKNNNNCVEGTWDKFTQGKQTVKSYNVFFWDWVHDMLHDS
VEWKTELSKCINNNTNGNTCRNNNKCKTDCGCFQKWVEKKQQEWMAIKDHFGKQTDIVQQ
KGLIVFSPYGVLDLVLKGGNLLQNIKDVHGDTDDIKHIKKLLDEEDAVAVVLGGKDNTTI
DKLLQHEKEQAEQCKQKQEECEKKAQQESRGRSAETREDERTQQPADSAGEVEEEEDDDD
YDEDDEDDDVVQEEEEEKEEGTVAEVTEVTEVVEETVTEQEGVKPCDIVDKLFEDDKSLK
EACGLKYGPGGKEKFPIGSVSHQVVSVLPLVERRRQYVCHLGDDDYT
Download sequence
Identical sequences A0A0L7M8M3
PFDG_04719T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]