SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L7RG32 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L7RG32
Domain Number 1 Region: 329-610
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.08e-55
Family Eukaryotic proteases 0.00063
Further Details:      
 
Domain Number 2 Region: 86-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 123-165
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 4 Region: 3-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 40-74
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000115
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 6 Region: 208-253
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000375
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L7RG32
Sequence length 625
Comment (tr|A0A0L7RG32|A0A0L7RG32_9HYME) Limulus clotting factor C {ECO:0000313|EMBL:KOC69793.1} KW=Complete proteome; Reference proteome OX=597456 OS=Habropoda laboriosa. GN=WH47_07533 OC=Apoidea; Apidae; Habropoda.
Sequence
LEKFQCKNGDCILSSLLCDGKVDCKDKSDETIMECNKPGIACPDYAFRCSYGACVDGDAT
CNGIKDCIDNSDETLSRCTGTSQNEHTLCSKSQFNCNNGQCIDKGKLCDGTADCTNGSDE
TFIQCGSLPCLQRLFRCNYGACIDGDLKCNGVSNCADGSDESPELCRDTDTSVDFTSRPT
TISTTSYQPDISDDFTSRPTTSRPYHPPTLGYCTRLIYGCNPGYMIRGNLEVFCDTRGKW
LNIPVCTEIRCKALHSASRKAECSYHGEYVPCTSSVLPGTVARLACRISYNQDKTLFSVT
SSQVTCNRTGQWEPEPIRCIPELSLSNLTTKMHVLACGLSSPRNVPLIVNGTLPHITEFP
WHATLYRAESPSSPKKFICGATIVAERLLITAAHCIYDEINRKVQDASTFHIVTGNIYRD
FDSPLHDIRIVRKAQVKNVYIRCTYLGLDGNYAEDIAILEIAESFAFTTTLIPICLDFAN
SYNPLLEAGIFGKVAGFGRTAVGESSFILQAITVPYVTLQQCKSSSIQFETEKYITADKF
CAGYTDGTSVCDGDSGGGLVVQRGGLWYLGGIVSVSLGTTQSGGERHCDSYAYSLYTRIF
DYMTWIHNIVINVGAQKKPPACFAS
Download sequence
Identical sequences A0A0L7RG32

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]