SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8FXM8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8FXM8
Domain Number 1 Region: 387-710
Classification Level Classification E-value
Superfamily DNase I-like 3.93e-46
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.000071
Further Details:      
 
Domain Number 2 Region: 3-102
Classification Level Classification E-value
Superfamily SH2 domain 1.23e-19
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 3 Region: 1053-1117
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.96e-16
Family SAM (sterile alpha motif) domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L8FXM8
Sequence length 1123
Comment (tr|A0A0L8FXM8|A0A0L8FXM8_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF69502.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22004752mg OC=Octopus.
Sequence
MAFLHKGISRLQAEKRLLQNKEDGSFLIRESETVPGAYVLCLLCQGRVHKYRILPDLDGK
LSVQSENSLLEPRFVDLSHLVQEYMKRGDKNGLVCAMKKIVAVERSEKLDEPDSDDDDFE
ANAADPSARHNTVSTLRMQFLKNFARLDLSKTEGEFMTILKQYIDEGQDEDLVSMKAGNT
KLPGLQKLLWTIAKPLVKEFDNFLLKMGLVRDLFSDVPKEQKWKELEAENFGVEEMSNKF
NECKAALEDLQAGAQDFLKNYGIKDQGSHGDYTEIDFDMMKTAPFLQSVPQQPIPEAIFE
VRAVKHGKPMGRVTLKVDVQTGRLFAVKPSKDILDASNTFSHEKILQLIKKSTDNCRLDI
VIEGKKTFTYQFESVHARENFCQHICQMKSMHSTAEEIDQVSIFIGTWNMGTAPFTESLN
SWVRCQGAGKIREPLVMGVIPHDLYVIGTQESSLTEKDWVNCLKAQLRLSMSIDPEIVCV
CSLWGIRLVVFTKAEHQHRISHVEHSSVKTGIANALGNKGAVAISMYFNGTSICFINSHL
ASRSERLARRNQNYRDIIKGLSLGQKHLNVFDVTNQFHHVFWFGDLNYRVEENIHCVLNK
LQEGDIDSLLILDQLKMTQDCKDAFVGFREEAITFLPTYRMERGAKGKLVYNWRKVKKTT
GDRINVPSWCDRVMWRSYPGTFIENIAYGCADDILSSDHRPVFSSFNIGIASQFITNRES
LVDQTSVRIIFDLVQAEIRTCSSQYFVLEFYSNCLPNVISSNPNKTFYAEIAGLCCPQWT
KDSLPELHPIFGDRDYLEEQHILIAIRTRDGDHESYGECVVTLKDMYSVQPEPFEYMLTH
LGDETGIIRGKMHIYTPESAPRRRSSKKVYELVSIDTEYHDPELYLVDSPRLEKLNEGRY
VNAPPFNGFSGAGYPETNPAPVPALPPTTTSVATQVYPPDSQLSGDPWPFGITDKQGVLT
SFETSTDPMLGALPRKGKPYMGQSSLEVGQRPMLPAPVTPVGSTGTSKMTESAVFSFSST
GPESASAEARDATMAPPVPTPRKTKHQSDAGYAHLKKPDTVQEWLGCLGLSEYTNTFIIN
GWDSISYLGYLTNDDLVNMHIRNPKHRDRLLRSLQDMNLKFTG
Download sequence
Identical sequences A0A0L8FXM8
XP_014785960.1.24776 Ocbimv22004752m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]