SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8HSU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8HSU6
Domain Number 1 Region: 165-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 109-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 221-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 67-119
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.45e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L8HSU6
Sequence length 281
Comment (tr|A0A0L8HSU6|A0A0L8HSU6_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF92279.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22007034mg OC=Octopus.
Sequence
MECELRERPVVIKSELCETPIPIKTESEDIDFPNDMLTDKGGNSTHSDIIGISLSETSPI
TDQSSTHTGDKPHHCDICGKAISNKNALTIHKRIHTGEKPYHCDVCGKSFSARGDLTRHK
IIHTGEKPYHCEVCGKSFSQRIHLTFHKSIHTGIKPYCCDYCGKSFSRKDDLSKHKRIHT
GEKPFHCDICGKSSSTSSDLNMHKRIHTGEKPYHCDICGKSFSGSSDLTRHKHIHTKEKQ
HLCDICGKSFSGSTELAEHKHIHTGEKPYHCDLCDKSFTQK
Download sequence
Identical sequences A0A0L8HSU6
Ocbimv22007034m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]