SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8HVN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8HVN4
Domain Number 1 Region: 229-325
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000587
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8HVN4
Sequence length 377
Comment (tr|A0A0L8HVN4|A0A0L8HVN4_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF93254.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22004795mg OC=Octopus.
Sequence
MSLRSYSAFGSNFKNRHNFANSSNRSSYSSIHSYTKSEQYWWNYTDNAKGTNFQRAVSGD
KRPRFEDDTWDLADSLADLYLKVNEENIATASKFTVCKDPVNDIDVKKWIEEDTSHGFIR
VFVPNGNINSSRLVPCNLSTNTQRICAQCGVAHSSLHVQFNGDIIARMESTDHPLAIQNE
FLGNLGYTEPRKIQEEGYNPDLSYLIKFYLGKPVQDSTFTKAQLSSVILVRKGKLIYQWV
QRLCAISGTRLFIHRDKFPSSKKSIMQLAKGYVEEVKFKDHPNVLKLTITLHGERSIYLS
FTNTITYSKWLKRVQKATAKLPTKADLSKCNLEFLPDTIFINEDLRTLNLRHNVLKERPL
EEDIHTMGWLDDLPRYV
Download sequence
Identical sequences A0A0L8HVN4
XP_014768997.1.24776 Ocbimv22004795m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]