SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8HW37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8HW37
Domain Number 1 Region: 5-56
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 0.0000275
Family Archaeal IMP cyclohydrolase PurO 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8HW37
Sequence length 60
Comment (tr|A0A0L8HW37|A0A0L8HW37_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF93417.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22004488mg OC=Octopus.
Sequence
MDKGRNFKYKRCIFKQHVEATDGHGKQSIKDIYIIYHITKVIDNIEVAWNGLTLDCMNRF
Download sequence
Identical sequences A0A0L8HW37
Ocbimv22004488m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]