SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8I9F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8I9F2
Domain Number 1 Region: 126-183
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 2 Region: 70-127
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.6e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 168-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.46e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 33-84
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.53e-17
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8I9F2
Sequence length 228
Comment (tr|A0A0L8I9F2|A0A0L8I9F2_OCTBM) Uncharacterized protein {ECO:0000313|EMBL:KOF98049.1} KW=Complete proteome; Reference proteome OX=37653 OS=Octopus bimaculoides (California two-spotted octopus). GN=OCBIM_22027473mg OC=Octopus.
Sequence
MEDKVSEYKVECKKLFKQIDFPDDRKKKKGKTLYQCDVCKKTFTLKFNLTAHKSIHTGER
PYQCDICGKAFPVNCHLTRHKRLHTDDKPYRCDICGMSFFIGSQLTKHIRTHTGERPYHC
GICGKSFSLSSTLYEHKRIHTDERPYLCDICGRSFSRKYCLTSHKRRHSGEKPHNCDICG
KSFTGGSYLTTHKRIHTGERPFHCEICGKAFSASSTLTIHKRIHTESR
Download sequence
Identical sequences A0A0L8I9F2
Ocbimv22027474m.p

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]