SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8VFT5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8VFT5
Domain Number 1 Region: 33-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.69e-31
Family Thioltransferase 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L8VFT5
Sequence length 150
Comment (tr|A0A0L8VFT5|A0A0L8VFT5_9SACH) Glutaredoxin {ECO:0000256|PIRNR:PIRNR005894} KW=Complete proteome OX=252598 OS=Saccharomyces sp. 'boulardii'. GN=KO01_05086 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MFLPKFNPIRSFSPILRAKTLLRYQNRMYLSTEIRRAIEDAIESAPVVLFMKGTPEFPKC
GFSRATIGLLGNQGVDPAKFAAYNVLEDPELREGIKEFSEWPTIPQLYVNKEFIGGCDVI
TSMARSGELADLLEEAQALVPEEEEETKDR
Download sequence
Identical sequences A0A0L8VFT5 A6ZWI9 B3LL09 C8ZIX1
YPL059W YPL059W YPL059W YPL059W tr|A6ZWI9|A6ZWI9_YEAS7 YPL059W YPL059W SCRT_02433 YPL059W YPL059W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]