SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8VI50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8VI50
Domain Number 1 Region: 357-640
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-72
Family Protein kinases, catalytic subunit 0.000000124
Further Details:      
 
Domain Number 2 Region: 4-114
Classification Level Classification E-value
Superfamily PH domain-like 1.75e-18
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L8VI50
Sequence length 655
Comment (tr|A0A0L8VI50|A0A0L8VI50_9SACH) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS00977200} KW=Complete proteome OX=252598 OS=Saccharomyces sp. 'boulardii'. GN=KO01_04912 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MKGVKKEGWISYKVDGLFSFLWQKRYLVLNDSYLAFYKSDKCNEEPVLSVPLTSITNVSR
IQLKQNCFEILRATDQKENISPINSYFYESNSKRSIFISTRTERDLHGWLDAIFAKCPLL
SGVSSPTNFTHKVHVGFDPKVGNFVGVPDSWAKLLQTSEITYDDWNRNSKAVIKALQFYE
DYNGLDTMQFNDHLNTSLDLKPLKSPTRYIINKRTNSIKRSVSRTLRKGKTDSILPVYQS
ELKPFPRPSDDDYKFTNIEDNKVREEGRVHVSKESTADSQTKQLGKKEQKVIQSHLRRHD
NNATFKPHRLAPSAPATKNYDRKTKWHKEDLLELKNNDDSNEIIMKMKTVAIDVNPRPYF
QLVEKAGQGASGAVYLSKRIKLPQENDPRFLKSHCHRVVGERVAIKQIRLSEQPKKQLIM
NELLVMNDSRQENIVNFLEAYIIDDEELWVITEYMEGGCLTDILDAVVRSNTGEHSSPLN
ENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRA
TMVGTPYWMAPEIVNQKGYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALYLIANNGSP
KLRHPESVCKETKQFLDACLQVNVESRASVRKLLTFEFLSMACSPEELKVSLKWH
Download sequence
Identical sequences A0A0L8VI50 A6ZN97 B3LIV2 C7GSS3
YOL113W YOL113W YOL113W YOL113W YOL113W YOL113W tr|A6ZN97|A6ZN97_YEAS7 SCRT_01292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]