SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8VI98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8VI98
Domain Number 1 Region: 18-268,307-335
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00000000000000596
Family BAR domain 0.05
Further Details:      
 
Domain Number 2 Region: 307-423
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000575
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L8VI98
Sequence length 1229
Comment (tr|A0A0L8VI98|A0A0L8VI98_9SACH) SIP3p Transcription cofactor {ECO:0000313|EMBL:KOH48166.1} KW=Complete proteome OX=252598 OS=Saccharomyces sp. 'boulardii'. GN=KO01_04165 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSVHGRDPKKRQLRLISVAFKEASIDSPSFRASVNFFQTRVDALEDWIEKTVDFFDQKYK
VSFEDFRRAKETLLSQLLPPPALLSNGFVSNQSFTPRLIDSFNKDYYDFSMKLLQIVKGD
DSSHSTALLELMTTAIEPYRNVRKNFDFYQGKYDSMLASYQAIRISKTSLEPSSIKSDAL
QLFEVQKNYLKASLDLISAISAVKLSLDKFILESMKVLKSRSIFITKDSGRKIDLSPCIN
EYLDNYAIWVENSIEGSKVLDSDISNAKKQAYRYTLKRITPSSDTSDYNIRSIHSSKLLS
KDTQVPPKSPEKSGWLYMKTQVGKPTREIWVRRWCFLKNAVFGMFLLSPSKTYVEETDKF
GVFLTNVRYDPEEDRKFCFEVKIFGNKVTEAHDNMSKDITLVFQTSNYLDLKSWLIAFEA
TKKYVMSIQHDSLEYELAFKRFSPKFFEFASSTTTSIDQLITTFDKETESLYETLNCSIS
EYDILTLGEEKVFQFQMPTTPISTKMTQLAILSNFLTKGSWFPNAVLANIWGTTDWSEYT
ILPGKGKKPSSLLTIDGKRLPIRNSTIYPQYYSNELKVLDLQFKSLVFSPDQRLEKLPEE
LLLFKFEAFWCPNKKQKFSATCFCTKDYIYCYMNSMEFICLTKISLSEIVSVEADRSSKK
TLKLYDASGLQMKAIVLFSDYKLIASKLQYLLENKAIKNPNSNEEILVKFEQMEKESQEK
KQEELYKIEQENSFDRKATSVSKIIKSRVTFWEMSDDASTLLNRLKKLQTEYSITYNHEY
EISSKGLAHILFGDKSNAFPKCLFLARKDGEEHGKRFWYKNKDINGKSQLVRKIPFRLDM
TGNFLNTGKYHRDKESKMIFATQRIVKIVDNKYYEVDLDPFFVKVPFCHLLKLSIKFVIT
ESYDVDNHLEIKLNMTASSSSLHVLYKLEYIDSRTGKTIEKLSLAEIICQTWALKFAHSE
FLLIRRVLRYYLEKIGKHGKVIKAIKLCGILGVLSNKSEEPATEKNGNSKESESMQYDIR
YSCTILFLVFIKLMVYRVTNLTFVFFRILIGILLLCAEKFSRINRMMVVGLLASIMINIL
LSEKASVPYWSIKRAEKLFHDRLGSDKFTMQRAIYISDSDLLSSQLSVPSNNPIFEKFSE
DNFNKDYQYSETRKQLAMRRNELLIELRILQDMEKQLVHDDYEKFLLEEVNKCSMVSIEM
TDLWFNDTQLQNYCSICNEELEKLRPPIT
Download sequence
Identical sequences A0A0L8VI98 B3LPA0
YNL257C SCRT_03386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]