SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8VL78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8VL78
Domain Number 1 Region: 592-717
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-30
Family Ran-binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8VL78
Sequence length 720
Comment (tr|A0A0L8VL78|A0A0L8VL78_9SACH) NUP2p Nucleoporin involved in nucleocytoplasmic transport {ECO:0000313|EMBL:KOH49224.1} KW=Complete proteome OX=252598 OS=Saccharomyces sp. 'boulardii'. GN=KO01_03564 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MAKRVADAQIQRETYDSNESDDDVTPSTKVASSAVMNRRKIAMPKRRMAFKPFGSAKSDE
TKQASSFSFLNRADGTGEAQVDNSPTTESNSRLKALNLQFKAKVDDLVLSKPLADLRPLF
TRYELYIKNILEAPVKSIENPTQTKGNDAKPAKVEDVQKSSDSSSEDEVKVEGPKFTIDA
KPPISDSVFSFGPKKENRKKDESDSENDIEIKGPEFKFSGTVSSDVFKLNLSTDKNEKKT
ETNAKPFSFSSATSTTEQTKSKNPLSLTEATKTNVDNNSKAEASFTFGTKHAADSQNNKP
SFVFGQAAAKPSLEKSSFTFGSTTIEKKNDENSTSNSKPEKSSDSNDSKPSFSFSIPSKN
TPDASKPSFNFGVPNSSKNETSKPVFSFGAATPSAKEASQEDDNNNVEKPSSKPAFNFIS
NAGTEKEKESKKDSKPAFSFGISNGSESKDSDKPSLPSAVDGENDKKEATKPAFSFGINT
NTTKTADTKAPTFTFGSSALADNKEDVKKPFSFGTSQPNNTPSFSFGKTTANLPANSSTS
PAPSIPSTGFKFSLPFEQKSGQTTTNDSKEESTTEATGNESQDATKVDATPEESKPINLQ
NGEEDEVALFSQKAKLMTFNAETKSYDSRGVGEMKLLKKKDDPSKVRLLCRSDGMGNVLL
NATVVDSFKYEPLAPGNDNLIKAPTVAADGKLVTYIVKFKQKEEGRSFTKAIEDAKKEMK
Download sequence
Identical sequences A0A0L8VL78 B3RHK8 B5VNM6
SCRT_04281 YLR335W YLR335W YLR335W YLR335W YLR335W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]