SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8VMP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8VMP0
Domain Number 1 Region: 339-405
Classification Level Classification E-value
Superfamily TPR-like 0.000000175
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 
Weak hits

Sequence:  A0A0L8VMP0
Domain Number - Region: 270-345
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00732
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0L8VMP0
Sequence length 746
Comment (tr|A0A0L8VMP0|A0A0L8VMP0_9SACH) CHS6p Member of the ChAPs (Chs5p-Arf1p-binding protein) family {ECO:0000313|EMBL:KOH49729.1} KW=Complete proteome OX=252598 OS=Saccharomyces sp. 'boulardii'. GN=KO01_02683 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MNLFWPSETKKQNEIPGGDYTPGNSPSVQKGYQFLNRDIFKSCPRIMERQFGECLHNRTH
LIKDLISSGNVGLGPIEIVHMSYLNKHEKEEFGEYFYVTGIEVSGPAMPVEFLEVLKSSK
RISKNISNNIILTYCCFNFFSNLDIRIRYDADDTFQTTAIDCNKETTDLTMTEKMWEETF
ASSVIRAIITNTNPELKPPGLVECPFYVGKDTISSCKKIIELLCRFLPRSLNCGWDSTKS
MQATIVNNYLMYSLKSFIAITPSLVDFTIDYLKGLTKKDPIHDIYYKTAMITILDHIETK
ELDMITILNETLDPLLSLLNDLPPRDADSARLMNCMSDLLNIQTNFLLNRGDYELALGVS
NTSTELALDSFESWYNLARCHIKKEEYEKALFAINSMPRLRKNDGHLETMYSRFLTSNYY
KKPLNGTREHYDLTAMEFTNLSGTLRNWKEDELKRQIFGRIAMINEKKIGYTKEIWDDIA
IKLGPICGPQSVNLINYVSPQEVKNIKNINLIARNTIGKQLGWFSGKIYGLLMEIVNKIG
WNGLLNIRTEAFMMETEFYQASNNIIDENGHIPMESRKKRFCEGWLDDLFLDLYQDLKLS
KISLSNKDEKHSGLEWELLGLIMLRTWHWEDAVACLRTSIVARFDPVSCQQLLKIYLQPP
KNIQEVTLLDTDTIISLLIKKISYDCRYYNYCQIFNLQLLEKLCNELGTHILRNKILLQP
SIGDEIMVMIDAMLAWIADLDHTVQP
Download sequence
Identical sequences A0A0L8VMP0 N1P321 P40955
YJL099W NP_012436.1.97178 4932.YJL099W YJL099W YJL099W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]