SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8VPM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8VPM1
Domain Number 1 Region: 344-509
Classification Level Classification E-value
Superfamily TPR-like 1.14e-28
Family Tetratricopeptide repeat (TPR) 0.0044
Further Details:      
 
Domain Number 2 Region: 125-219
Classification Level Classification E-value
Superfamily TPR-like 6.51e-26
Family Tetratricopeptide repeat (TPR) 0.00082
Further Details:      
 
Domain Number 3 Region: 477-588
Classification Level Classification E-value
Superfamily TPR-like 0.000000036
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0L8VPM1
Sequence length 639
Comment (tr|A0A0L8VPM1|A0A0L8VPM1_9SACH) TOM71p Mitochondrial outer membrane protein {ECO:0000313|EMBL:KOH50318.1} KW=Complete proteome OX=252598 OS=Saccharomyces sp. 'boulardii'. GN=KO01_02302 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MAENSLLRFITKNKVAILATVSAGTAAVGAYVYYQQIKQQQQQQLKGTKDNRRQSEAFAG
QNEDEADLKDDGSVVSGSNKRKKKKNKRKRNNKAKSGEGFDYPSLPNGEPDIAQLKGLSP
SQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKV
IEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGDFDGASIEPMLERNL
NKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLEVSSVNTSSNYDTAYALLSD
ALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLRENAALALCYTGIFHFLKNN
LLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQ
MYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPTLP
EVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKATILARQSSQDPTQ
LDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEK
LQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGML
Download sequence
Identical sequences A0A0L8VPM1 N1P153 P38825
YHR117W 4932.YHR117W YHR117W NP_011985.1.97178 YHR117W YHR117W YHR117W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]