SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0L8VUD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0L8VUD5
Domain Number 1 Region: 7-48
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000117
Family TBP-associated factors, TAFs 0.015
Further Details:      
 
Weak hits

Sequence:  A0A0L8VUD5
Domain Number - Region: 190-254,293-314
Classification Level Classification E-value
Superfamily Histone-fold 0.000335
Family TBP-associated factors, TAFs 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0L8VUD5
Sequence length 337
Comment (tr|A0A0L8VUD5|A0A0L8VUD5_9SACH) SPT3p Subunit of the SAGA and SAGA-like transcriptional regulatory complexes {ECO:0000313|EMBL:KOH51837.1} KW=Complete proteome OX=252598 OS=Saccharomyces sp. 'boulardii'. GN=KO01_01167 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MMDKHKYRVEIQQMMFVSGEINDPPVETTSLIEDIVRGQVIEILLQSNKTAHLRGSRSIL
PEDVIFLIRHDKAKVNRLRTYLSWKDLRKNAKDQDASAGVASGTGNPGAGGEDDLKKAGG
GEKDEKDGGNMMKVKKSQIKLPWELQFMFNEHPLENNDDNDDMDEDEREANIVTLKRLKM
ADDRTRNMTKEEYVHWSDCRQASFTFRKNKRFKDWSGISQLTEGKPHDDVIDILGFLTFE
IVCSLTETALKIKQREQVLQTQKDKSQQSSQDNTNFEFASSTLHRKKRLFDGPENVINPL
KPRHIEEAWRVLQTIDMRHRALTNFKGGRLSSKPIIM
Download sequence
Identical sequences A0A0L8VUD5 A0A250W8E4 B3LFQ8 C7GSD0 C8Z5V6 G2WBD2 N1P747 P06844
YDR392W YDR392W YDR392W 4932.YDR392W YDR392W YDR392W YDR392W YDR392W YDR392W YDR392W YDR392W YDR392W YDR392W YDR392W YDR392W SCRT_00138 YDR392W YDR392W YDR392W YDR392W NP_010680.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]