SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0K1J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0K1J6
Domain Number 1 Region: 42-236
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.43e-31
Family PAPS reductase-like 0.0011
Further Details:      
 
Domain Number 2 Region: 324-428
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000158
Family PDI-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M0K1J6
Sequence length 434
Comment (tr|A0A0M0K1J6|A0A0M0K1J6_9EUKA) Phosphoadenylylsulfate reductase {ECO:0000313|EMBL:KOO32680.1} KW=Complete proteome; Reference proteome OX=1460289 OS=Chrysochromulina sp. CCMP291. GN=Ctob_004267 OC=Chrysochromulina.
Sequence
MFLIAAAALSYAPGLTPPAVSSRVSAVSMKGFDQEQFIQQSKDMRLKHLEEQAMFALKTS
CENFNKAVFPNAMIAGDVVITDLLSRLGYLENGKCTIMCVDTFHLFPETMPFLATLEKKY
KFKAVIFGPEGVPAGDKAAFDKKYGENLWREDIEQYDKVCKVEPFGRGLKTLGTDCMING
RTRWQGFERAWIDQFENAPVNGGLAKCNPLAYWTLEDVFDYIAKYKVPYHPSHENGYPSH
GDLKDTIPVPSMDERAKKQEEGFTAFKDYKWVGDKTKWLDYATERVGRFVGLKNKDGSTK
TECGIHVAGAEKTFDRDLWDKADNVKNLMTPDEVAKVRAAGEEAMLVVYAPWCKFCMAME
SEYSKLSAASGIPTYKFRGDEQRAYVEENLNTKSFPTVNFISADGTVTKYESEKRSVEDF
KAFIKSKSKSKVSA
Download sequence
Identical sequences A0A0M0K1J6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]