SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M0L4T1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M0L4T1
Domain Number 1 Region: 15-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.83e-27
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M0L4T1
Sequence length 277
Comment (tr|A0A0M0L4T1|A0A0M0L4T1_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KOO45887.1} KW=Complete proteome OX=86667 OS=Jeotgalibacillus marinus. GN=AMC98_04390 OC=Jeotgalibacillus.
Sequence
MRLNALKRVDLRIRLKDISEDEIKKVEKKLNLTLPQQYKKLIIQQNGGLINFNAFPTNQE
TSCADDHIEVDHIRGIEKDLGILESEYLIKEWGLPQKLLLIQGDGHNWVAWDYRQTNENP
PVHYFDLELNNDFKIADSFDEFLSKLYTYEDETHEYDNLDFDIHTIDPNDPDAIQKEEVE
KILISKNPLEIHRISLFPIQSLEDLEWILHIIKENSIEIKGDMAFELADVLMSIVSSYTH
QIKSANLRKIVREAAQELGKSKNADTEILLDQFKDFM
Download sequence
Identical sequences A0A0M0L4T1
WP_044059172.1.83369 WP_044059172.1.95507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]