SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M2VRU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M2VRU4
Domain Number 1 Region: 15-173
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000314
Family SMI1/KNR4-like 0.015
Further Details:      
 
Domain Number 2 Region: 181-245
Classification Level Classification E-value
Superfamily ClpS-like 0.0000014
Family Ribosomal protein L7/12, C-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M2VRU4
Sequence length 254
Comment (tr|A0A0M2VRU4|A0A0M2VRU4_9BACL) Uncharacterized protein {ECO:0000313|EMBL:KKO53214.1} KW=Complete proteome; Reference proteome OX=1642570 OS=Paenibacillus sp. DMB20. GN=XI25_14685 OC=Paenibacillus.
Sequence
MGNNYKEIDAVIEKMQAALEEMRKLDPEFYAKYPMNLVTEAEEKAMRMVSDKWRLPDEYL
YFLKHYVPESVAWSTDEYINLFIYGAEHLPEGQWGYNYNPVTNEEISDWPNSYLVIAMDE
GDPYCIDLSRGDTVIYTAEHGTGTWDFSIAYDHLAEFLHSVLLPRSSEEWETGEEVQYEY
YKVFITGEGSNKIKTLMFIKKTFSCDYSQAKSYLEEVPLQVYKGIDLGAAKIEAKLKSIG
ADYEMRKISFAEFL
Download sequence
Identical sequences A0A0M2VRU4
WP_046679253.1.55760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]