SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3GHB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3GHB3
Domain Number 1 Region: 8-179
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.27e-33
Family YdeN-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M3GHB3
Sequence length 185
Comment (tr|A0A0M3GHB3|A0A0M3GHB3_9RHIZ) Uncharacterized protein {ECO:0000313|EMBL:KKZ85568.1} KW=Complete proteome OX=1128399 OS=Rhizobium phaseoli Ch24-10. GN=RPHASCH2410_CH21570 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Rhizobium.
Sequence
MKASDADILIIPGYTNSGPGHWQSRWEAKLSTARRVEQAEWTKPVREDWIARIAEEVNAS
TRPVVLVAHSLGVPSAIHAIPLFRNRVAGAFFVAPPDVTNPDIRPKHLMTFGPYPRDPLP
FPSITVASRNDPFGSYEHADDMASSWGSFLVDAGEAGHINADSGHGPWPEGTMVFAQFLS
RLSAD
Download sequence
Identical sequences A0A0M3GHB3 A0A192TCT9 A0A1W6GIE3 B3PP54 F2AD34
491916.RHECIAT_CH0002386 gi|190891976|ref|YP_001978518.1| WP_004676258.1.10944 WP_004676258.1.12474 WP_004676258.1.19349 WP_004676258.1.22132 WP_004676258.1.22954 WP_004676258.1.25642 WP_004676258.1.26360 WP_004676258.1.35839 WP_004676258.1.76514 WP_004676258.1.79970 WP_004676258.1.81019 WP_004676258.1.82165 WP_004676258.1.84722 WP_004676258.1.88425 WP_004676258.1.9020 WP_004676258.1.96076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]