SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3J364 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3J364
Domain Number 1 Region: 57-110
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000968
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 2 Region: 29-60
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000183
Family Somatomedin B domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M3J364
Sequence length 196
Comment (tr|A0A0M3J364|A0A0M3J364_ANISI) Uncharacterized protein {ECO:0000313|WBParaSite:ASIM_0000197601-mRNA-1} KW=Complete proteome; Reference proteome OX=6269 OS=Anisakis simplex (Herring worm). GN= OC=Ascaridoidea; Anisakidae; Anisakis; Anisakis simplex complex.
Sequence
MIGDLMDYEDPIASGQLNQSRLRFLGSNPENICYCDEVCIAFGDCCSDYTFVCPPSDCYV
TNWSEWSACVLDDTAQKCGVGTRTRTREVRREANYGGAPCPDLVEQLSCFHECPPREEDV
TTVALLLDYKYNDIREKLSRDNIYWDLPEVASKVEKLSYYCVEYEIGWVNRNCIDKKITS
KLHEGNKICAECQPEA
Download sequence
Identical sequences A0A0M3J364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]