SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3KKY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3KKY6
Domain Number 1 Region: 12-269
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.48e-105
Family SCOPe 0.0000000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M3KKY6
Sequence length 282
Comment (tr|A0A0M3KKY6|A0A0M3KKY6_9PLAN) Esterase {ECO:0000313|PDB:4UHC, ECO:0000313|PDB:4UHD, ECO:0000313|PDB:4UHE} OX=1331910 OS=Thermogutta terrifontis. GN= OC=Planctomycetaceae; Thermogutta.
Sequence
MAQRVKITTTATPGEIELAFEDTGTGLPVLLVHGFPLDRTMWKAQREELCDEFRVIVPDL
RGFGESQVIPGVATMEAMADDLAGLCNHLGLTGKIVLGGLSMGGYVAFAFARKYRDRLAG
LILCDTRARPDSPEAKENRRRVAERVRREGPGFIAEEMIPRLCCESTFRNHPEVIEKIRQ
MILSAPPEGVAAAALGMAERPDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQS
QFVVIPDAGHLPPMEQPERVTQAIREWLRKVHTEAGHHHHHH
Download sequence
Identical sequences A0A0M3KKY6
4uhc_A 4uhd_A 4uhe_A 4uhf_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]