SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M3V4P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M3V4P9
Domain Number 1 Region: 331-664
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.75e-47
Family Patatin 0.0000588
Further Details:      
 
Domain Number 2 Region: 9-206
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.41e-25
Family Laminin G-like module 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0M3V4P9
Sequence length 677
Comment (tr|A0A0M3V4P9|A0A0M3V4P9_9NOSO) Patatin {ECO:0000313|EMBL:ALF52317.1} KW=Complete proteome; Reference proteome OX=224013 OS=Nostoc piscinale CENA21. GN=ACX27_04755 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence
MSNIVQTQTVLTFDGIDDYIDFGKNDLGGVFAQGSSTFTVSGWINPHQLTNKATSYGTRN
VFFARSSDRYSDNFEFGISEAGNLDIYIDETVTKGIKTFGQGELTIGSWHFFAIVFNQGK
LTVYLDEQEYTDSLRGTALNKATSPLTLGATLHKRVYFAGQLANISVWNYPCTLEQIQVH
RCGLIVGDEAGLVAYWKLDEGEGKTITSRTVAEQQGNLRGNPSWDVAQIPLSNLSSPQDE
IITTAEEKISPITTNLLAATVSLINQEEATPTNNQESDILLNLVTLPLQVTEPIPESISQ
SDVEDNVQPTKVATLIENQTPETMETTAKSKYKILSIDGGGIRGIIPALLLAEIERRTQK
PIFSLFDLIAGTSSGGILALGLTQPRLTSTTSEELFAEYTAEDLLQLFLEYGVEIFYEPF
FERILGPIEDIFLQPKYPSKGKEEILRQYFGTASLENNLKEVFVTSYDIEQRIPIFFTNQ
LHKEQIESKNFRNLCGGFSLLDVALATSATPTYFAPHRIPTSHNTSGFYTLIDGGVFANN
PAHLAIIEAQISSKKEANRVLNSEDILVVSLGTGSLTSVYPHNSVKNWGLLQWSRPLLNI
VFDGNSEVVSGELERLFEPSNQEAKSSYYRFQPFLEEELEAIDNIKLPNTRKLQAVAHQL
IAEYSQQIDELCSLLLA
Download sequence
Identical sequences A0A0M3V4P9
WP_062289142.1.4589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]