SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M4F1S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M4F1S1
Domain Number 1 Region: 324-603
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.52e-42
Family Eukaryotic proteases 0.00062
Further Details:      
 
Domain Number 2 Region: 137-179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 2-39
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 220-263
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000278
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 5 Region: 44-78
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000012
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 6 Region: 97-129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000589
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0M4F1S1
Sequence length 612
Comment (tr|A0A0M4F1S1|A0A0M4F1S1_DROBS) ModSP {ECO:0000313|EMBL:ALC45275.1} KW=Complete proteome; Reference proteome OX=30019 OS=Drosophila busckii (Fruit fly). GN=Dbus_chr3Rg25 OC=Ephydroidea; Drosophilidae; Drosophila.
Sequence
AACSDNKFECENGSCISQYDVCNGVKNCPDGSDETALNCISQREYCSKPYFQCSYGACVI
GTAACNGIKECADNSDETVLRCGNEDDIREFDRRQQGNCQENEIKCPSGICIDKSKYLCD
GHDDCGDGSGFDESVELCAHMECPGYSFKCASGSCIASQLVCNNASDCFDGSDEAPLLCN
TTGVSTQPTIKDTPIDQIGCPLPLGEERPIVKDRDQRLITPPIIRGTVYFHCNPGYFLQG
PESSHCANRKWGSPIVPKCVKYCDAKRDSSGSSKDMFNGYSTRATCLLQGQTVDCGKRYH
EPGTEIKFNCATGFQTLKTSLPDMKCLPSGHWSRERERCDQECGQIATPIKQFSADGYSI
NNTEVPWHVGLYTWHNERDYNFVCGGSLITPDLIITAAHCVFNEVTGHTYAKEIFRVVAA
KLYRGYNEVNSDERRRDVEDIVVAARYKGREDNFFNDLALIVLKQAFELSDVIRPVCIHF
STFAEKETINNNVEGRFAGWNYKEKRELQFVPAVSRMNSECVASLKDIRPDKFCMYTHGK
SLACHGDSGGGFTAKRETSAFSRDPFRHFLYGVISSAPNAGQCALSLTTLTNIQHFEEMI
TAEMEKSRNLRS
Download sequence
Identical sequences A0A0M4F1S1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]