SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0M4GCN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0M4GCN5
Domain Number 1 Region: 2-461
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.2e-68
Family Acetylcholinesterase-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0M4GCN5
Sequence length 515
Comment (tr|A0A0M4GCN5|A0A0M4GCN5_9ACTO) Uncharacterized protein {ECO:0000313|EMBL:ALC98404.1} KW=Complete proteome; Reference proteome OX=712122 OS=Actinomyces sp. oral taxon 414. GN=AM609_00980 OC=Actinomyces.
Sequence
MIIDTELGRLIAQRAGRAPDGGDVLQILGIPYARAERFRPPVPVGAPGVEASGKTAGSPA
APPTGEPINTGYGTCFPQRLVPRAVNLALRHFQLRPEWQPRGDVAGEDSLRVNVWTPLDG
APRPVLVFIHGGDCGSGTLPVYNGAHLAGRGVVVVTVTYRIGAFGHLHVVDGGTASCDRA
LLDQQAALRWVHEHIGALGGDPGNITLMGHCGGAQYALYQALNPDNAGLFHRLILASGQR
AVPVPLDLDAERRAFAAFLADNRLTREELGALPAGRLPRLRLPRARLVTVMERPFFCVDP
LAVLREGRFPRVPVLVGTTADEFSMIEMPLWYGRMGLATRGRDLGRRVREVYGGHGRRIA
AALRREADGLVDLQIRMMELVVFHGAALDLMKSFSRFTAVHGYRFEGVPKVYGGRPGSYH
GAEIAFFFGNLDRMRIPVTEEDAAVAGAVQRDWLAFIRDGAIPGRPAFDRGDPRLTRYRA
DGAVETVAFPHADLLGDLEGTDLAASVVDSYMRRR
Download sequence
Identical sequences A0A0M4GCN5
WP_053585771.1.12534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]