SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0KVD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0KVD3
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 6.54e-45
Family SMI1/KNR4-like 0.000000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N0KVD3
Sequence length 135
Comment (tr|A0A0N0KVD3|A0A0N0KVD3_9PSED) Cell wall assembly protein {ECO:0000313|EMBL:KPG78689.1} KW=Complete proteome OX=1690246 OS=Pseudomonas sp. RIT-PI-o. GN=AEQ63_24445 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEEIIEQLREANEPVPVPLELPDEDLLVEIEEQLFIDIPFVFKEFLLTVSDVVYGSLEPV
TVTDPQSHTYLPDVAANAWDVGVDRSLIPICQDGDDYYCVEEDGTVVLWQAEEELIAEET
WESVWHWARDVWLES
Download sequence
Identical sequences A0A0A6DHC0 A0A0D0IND9 A0A0N0KVD3 A0A142N4G5 A0A1H2KNE5
WP_038359443.1.24892 WP_038359443.1.31844 WP_038359443.1.36605 WP_038359443.1.46469 WP_038359443.1.65847 WP_038359443.1.73001 WP_038359443.1.74421 WP_038359443.1.95481 WP_038359443.1.96516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]