SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N0PDF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N0PDF1
Domain Number 1 Region: 588-771
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.98e-33
Family Eukaryotic proteases 0.0016
Further Details:      
 
Domain Number 2 Region: 771-945
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.69e-32
Family Eukaryotic proteases 0.0017
Further Details:      
 
Domain Number 3 Region: 289-358
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000005
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 4 Region: 107-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 56-92
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000707
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 6 Region: 195-228
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000746
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 7 Region: 228-269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 8 Region: 145-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0N0PDF1
Sequence length 948
Comment (tr|A0A0N0PDF1|A0A0N0PDF1_PAPMA) Putative vitellogenin receptor {ECO:0000313|EMBL:KPJ15425.1} KW=Complete proteome; Reference proteome OX=76193 OS=Papilio machaon (Old World swallowtail butterfly). GN=RR48_01339 OC=Papilionoidea; Papilionidae; Papilioninae; Papilio.
Sequence
MADGLCFACAVKDVISSVVSSQLEYLMKMSVEATLRRELPLTNPIFTAVVREEEGTCSPG
ELQCSDGSCVTTDRICDGLPDCPLREDEQYCDGVSKSLMSRSRRQATSNCRKNQWQCRDT
SCISFDGKCDGVIDCPDGSDETYPLCRSEKCQSNWFRCTYGACVDGTAPCNGIQECADNS
DELLPRCRNETDEVSSQFKCDNGQLISGFNHCDGVADCSDGSDETVKACAAKVCPNYLFQ
CAYGACVDQGADCNGIKECADNSDESDELCNRITGPITTTAKPLATGPCVLPPYPDHGSY
VVRGAPTASPGQGFKSFALTVSCYPGYALDGPESVLCFDGTWVPPMPKCIRYCKLPPHPS
VEYRCLLSDQAGVEGSRPCKEYEPTGTVVKPECRSPNYYASGTLTYMRCSEGTWDYIALC
SPGLIKNATNVTIIIKDNIEVHISQFQYASPITLVFPNAVQPITGKPNSVQPNPGSHISV
QFNEAETITIQPNNVRPVQPPTNRLSVQPNTGTSVLDRFTDRPIWPPLTTDLPSFLQVQP
IKPNEKSNESTDYDIDVNEWRMGVSTNAHNTKIKHTKENNTFPVNLDAAHCFWDDAQKQR
PSELYAVAVGKLYRPWNLNVDVDAQKSDVKDIKIPPRFQGAASNFQDDIALVILKTRIEY
KYYVRPVCLDFDINFNRRQLQPNKLGKVAGWGLTSINGVAAGTLQVVNIPYVSIEKCIAT
APPGFREYITSDKVCAGYDNGTALCKGDSGGGLAFPELDKGIERFYLRGVVKDIKIPPRF
QGAASNFQDDIALVILKTRIEYKYYVRPVCLDFDINFNRRQLQPNKLGKVAGWGLTSING
VAAGTLQVVNIPYVSIEKCIATAPPGFREYITSDKVCAGYDNGTALCKGDSGGGLAFPEL
DKGIERFYLRGVVSTAPSNENLCNANTLTTFTHLLSHEHFIKEHLQLD
Download sequence
Identical sequences A0A0N0PDF1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]