SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0N1PIR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0N1PIR0
Domain Number 1 Region: 778-1030
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.08e-50
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 532-781
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.13e-45
Family Eukaryotic proteases 0.0012
Further Details:      
 
Domain Number 3 Region: 42-154
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000000000852
Family Eukaryotic proteases 0.016
Further Details:      
 
Domain Number 4 Region: 413-470
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000375
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 348-387
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 313-345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000628
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 7 Region: 230-266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 265-306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000798
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0N1PIR0
Sequence length 1042
Comment (tr|A0A0N1PIR0|A0A0N1PIR0_PAPMA) Low-density lipoprotein receptor-related protein 2 {ECO:0000313|EMBL:KPJ16373.1} KW=Complete proteome; Reference proteome OX=76193 OS=Papilio machaon (Old World swallowtail butterfly). GN=RR48_01357 OC=Papilionoidea; Papilionidae; Papilioninae; Papilio.
Sequence
MEVIPPLFDEAGGLILVTFPFPPFSYKEMMKGEIDLAKDGRIAAGWGLTTGLAGSEAPRL
KVIELPYENYESCLNLTTPALSRYLTYDDKICAGSLDGDALCRGDSGGGLAFPWDEDGKA
RFYLRGVASTSPPSNDVTVCNVRALTSFTSVIKFEKFYSGRSRNNNICWVHELSSLSEIP
QPYRRQALSGTIFILEIKASFLSNHDYMRSNESYSQNLSLNRTKRDLDECSYNEYECKDG
SCVRANSDCDGIYDCADGSDEAFSLCRNRKCREKQFRCNYGACVDKFNDVCNKRVDCADG
SDELSEKCTGIKLTNGDNFICRNGQLIPKKGRCDGVTDCADGTDENIAACVNITCDIGQF
VCEYGGCVDGKSLCNGTAECRDGSDERLDICGRLTLIKVSDISTTEAPVTTPKCVLPPEP
QNGVYRIISETNSSDADYVYLQYDCYPGFRLIGEPKILCWRGVWPKIPYCIQTCPLRKDP
SIEYQCTEEDLETPRQCEEEEVEGAIVRPACRQPHYYSPVELPYMHCSQGAWSSGPVCVA
ECGTTPPIVSQLVLGGETARNGEIPWHAGIYFKDPSVNIYQQICGGSLVSTTVVLSAAHC
FWNEVTKRLENKHNYAVAVGKLYRDWDHVKDERFVQKSNISKIAVPKLYRGIELDYHHDI
AVVIVTKPFEYKLHISPVCLDFRPDFNNEQLQSGQLGKAAGWGLTTKYRGSESQELKVIE
LPYEDLDRCINLTSRQLKHYVVYDKICAGSLDGEALCRGDSGGGLAFLSEVSGVSRYYLR
GGHVAERGELSWHAGIYTGAKQYEQICGGSLIRRSTIVSAAHCFYDDNKEGMKSAKNFAA
AVGKIYRAWNDPRDRDGQKRYVKELHIPETYKGSENNYQDDIALVIVDKPFTYTSYIRPV
CLDFRTDFEMEQLRPGNMGKVAGWGMKDTSGHASDVLKVVELPVVEFNVCWERAPFEFKS
HITSNKFCAGYYNGTALCKGDSGGGLSFSATEFGVIRYYLRGIVSTSPAASDQDLCNALT
VTTFTKVTLQETFFSDYLHEEY
Download sequence
Identical sequences A0A0N1PIR0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]